PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G069047_P02
Common NameLOC100272652, ZEAMMB73_863482
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 100aa    MW: 11642.4 Da    PI: 10.6325
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G069047_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.47.1e-33259755128
                NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s   + +g++ktLvfy+grap+g+k+dW+mheyrl
  GRMZM2G069047_P02  25 QNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS-AVRRMGMRKTLVFYRGRAPHGHKSDWIMHEYRL 97 
                        579*************************************.8899***************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100532.7221100IPR003441NAC domain
SuperFamilySSF1019414.84E-3223100IPR003441NAC domain
PfamPF023651.2E-162697IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MALIIGVSYR FCVHAERCKI GSGPQNDWYF FSHKDKKYPT GTRTNRATAA GFWKATGRDK  60
AIYSAVRRMG MRKTLVFYRG RAPHGHKSDW IMHEYRLDDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-282510073148NAC domain-containing protein 19
3swm_B3e-282510073148NAC domain-containing protein 19
3swm_C3e-282510073148NAC domain-containing protein 19
3swm_D3e-282510073148NAC domain-containing protein 19
3swp_A3e-282510073148NAC domain-containing protein 19
3swp_B3e-282510073148NAC domain-containing protein 19
3swp_C3e-282510073148NAC domain-containing protein 19
3swp_D3e-282510073148NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G069047
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G069047_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0391131e-141BT039113.1 Zea mays full-length cDNA clone ZM_BFb0371D07 mRNA, complete cds.
GenBankJN6340781e-141JN634078.1 Zea mays secondary wall NAC transcription factor 2 mRNA, complete cds.
GenBankKJ7276851e-141KJ727685.1 Zea mays clone pUT5624 NAC transcription factor (NAC115) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008676756.13e-64secondary wall NAC transcription factor 2 isoform X1
SwissprotQ84WP62e-53NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A3L6F7521e-55A0A3L6F752_MAIZE; NAC domain-containing protein 43
TrEMBLB4FPS51e-55B4FPS5_MAIZE; NAC domain-containing protein 43
STRINGGRMZM2G069047_P012e-56(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.15e-45NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]