PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G069028_P03 | ||||||||
Common Name | ns1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 193aa MW: 21485.4 Da PI: 11.0046 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 66.1 | 4.7e-21 | 6 | 66 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++R+++t+eql +Lee++++ r+p+a+e+++++++l +++ ++V++WFqN++a+e++ GRMZM2G069028_P03 6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66 58*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 121.8 | 2.8e-39 | 5 | 67 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+ GRMZM2G069028_P03 5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67 689***********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 10.463 | 2 | 67 | IPR001356 | Homeobox domain |
SMART | SM00389 | 6.8E-6 | 4 | 71 | IPR001356 | Homeobox domain |
CDD | cd00086 | 2.10E-4 | 5 | 60 | No hit | No description |
Pfam | PF00046 | 1.0E-18 | 6 | 66 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 8.13E-12 | 7 | 67 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 6.7E-8 | 8 | 66 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH 60 KARERQRLRR RLCARHQQQY AQQQATAAAP ASSPNSSATV PSLAAGGSSA GVHPAVMQLH 120 HHQHPYATNF MPHQLVVVPM EVELGYTTAA AAISWRSGRP QMQWSTATPA AVRHRAALTR 180 VARSSCRHAA AVL |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G069028 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in tissues enriched for shoot meristems and young lateral organ primordia. First expressed in lateral domains of shoot meristems. It is then expressed in the margins of young lateral organ primordia. Not expressed in roots, seedling leaves or fully expanded coleoptiles. Also expressed in vegetative shoot apices (five leaf primordia and the SAM) and in the male inflorescence. Expressed at low level in the female inflorescence. {ECO:0000269|PubMed:15169755}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in leaf formation. {ECO:0000269|PubMed:15169755}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G069028_P03 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ536578 | 0.0 | AJ536578.1 Zea mays mRNA for homeodomain transcription factor (prs gene). | |||
GenBank | BT066120 | 0.0 | BT066120.1 Zea mays full-length cDNA clone ZM_BFb0350F05 mRNA, complete cds. | |||
GenBank | JX469942 | 0.0 | JX469942.1 Zea mays subsp. mays clone UT3202 HB-type transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105160.1 | 1e-70 | WUSCHEL-related homeobox 3A | ||||
Swissprot | Q70UV1 | 1e-71 | WOX3A_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | A0A3L6G2S1 | 3e-69 | A0A3L6G2S1_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | C0PCV1 | 3e-69 | C0PCV1_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | K4JBS6 | 3e-69 | K4JBS6_MAIZE; HB-type transcription factor (Fragment) | ||||
STRING | GRMZM2G069028_P01 | 4e-70 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28610.1 | 5e-36 | WOX family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G069028_P03 |
Publications ? help Back to Top | |||
---|---|---|---|
|