PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G069028_P02 | ||||||||
Common Name | ns1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 246aa MW: 25981.9 Da PI: 8.2208 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 46.6 | 5.7e-15 | 2 | 50 | 14 | 57 |
HHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 14 eLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +Lee++++ r+p+a+e+++++++l +++ ++V++WFqN++a+e++ GRMZM2G069028_P02 2 ILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 50 8******99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 93.5 | 1.9e-30 | 1 | 51 | 14 | 64 |
Wus_type_Homeobox 14 kiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 +iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+ GRMZM2G069028_P02 1 MILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 51 69************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 9.88 | 1 | 51 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.2E-12 | 2 | 50 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-4 | 2 | 50 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.02E-7 | 2 | 51 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MILEEMYRSG VRTPNAAEIQ QITAHLAYYG RIEGKNVFYW FQNHKARERQ RLRRRLCARH 60 QQQYAQQQAT AAAPASSPNS SATVPSLAAG GSSAGVHPAV MQLHHHQHPY ATNFMPHQLG 120 YMGQQVATVP PVLNPAAAGM VDLAAARAGG GNKATAAGSG AYGGGAGLYN SCSSNQLEEW 180 EATDAMEHCD ASCGAASGSS DEGGALQLPP CCRRPLKTLD LFPTKSTGLK DECSSSKSSS 240 CSTSTN |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G069028 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in tissues enriched for shoot meristems and young lateral organ primordia. First expressed in lateral domains of shoot meristems. It is then expressed in the margins of young lateral organ primordia. Not expressed in roots, seedling leaves or fully expanded coleoptiles. Also expressed in vegetative shoot apices (five leaf primordia and the SAM) and in the male inflorescence. Expressed at low level in the female inflorescence. {ECO:0000269|PubMed:15169755}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in leaf formation. {ECO:0000269|PubMed:15169755}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G069028_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ536578 | 0.0 | AJ536578.1 Zea mays mRNA for homeodomain transcription factor (prs gene). | |||
GenBank | BT066120 | 0.0 | BT066120.1 Zea mays full-length cDNA clone ZM_BFb0350F05 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105160.1 | 0.0 | WUSCHEL-related homeobox 3A | ||||
Swissprot | Q70UV1 | 0.0 | WOX3A_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | A0A3L6G2S1 | 0.0 | A0A3L6G2S1_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | C0PCV1 | 0.0 | C0PCV1_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | K4JBS6 | 0.0 | K4JBS6_MAIZE; HB-type transcription factor (Fragment) | ||||
STRING | GRMZM2G069028_P01 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28610.1 | 3e-25 | WOX family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G069028_P02 |
Publications ? help Back to Top | |||
---|---|---|---|
|