PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G067702_P02 | ||||||||
Common Name | GLK56, LOC100280967, ZEAMMB73_414660, Zm.15210 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 195aa MW: 20943.8 Da PI: 10.3738 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 97.3 | 1.1e-30 | 92 | 145 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +prl+Wtp+LH+rFv++v++L G++kA+Pkti+elm+v+gLt+e+v+SHLQkYRl GRMZM2G067702_P02 92 RPRLVWTPQLHKRFVDVVAHL-GIKKAVPKTIMELMNVEGLTRENVASHLQKYRL 145 59*******************.********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.913 | 89 | 148 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-31 | 90 | 150 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.63E-19 | 91 | 149 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.1E-25 | 93 | 145 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.7E-8 | 95 | 144 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0042753 | Biological Process | positive regulation of circadian rhythm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MEWESGLPGA DELTPLSQPL VPPGLAAAFR IPPEPGRTLL DLHRASEATV ARLRRAPPSS 60 PGTSSSPHGH QEARGGEGAD SAAATTTNSN RRPRLVWTPQ LHKRFVDVVA HLGIKKAVPK 120 TIMELMNVEG LTRENVASHL QKYRLYVKRM RGQGPSPSDH IFAPTPVHGV AVGMVPMVSG 180 QAYHYLYNGG GGGDR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 2e-33 | 92 | 148 | 1 | 57 | Transcription factor LUX |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.15210 | 0.0 | ovary |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G067702 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00014 | PBM | Transfer from AT3G46640 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G067702_P02 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT055527 | 0.0 | BT055527.1 Zea mays full-length cDNA clone ZM_BFc0052N18 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008654896.1 | 1e-140 | ARR1 protein-like isoform X1 | ||||
Swissprot | Q94DH3 | 3e-72 | PCL1_ORYSJ; Transcription factor PCL1 | ||||
TrEMBL | A0A3L6DQG0 | 1e-139 | A0A3L6DQG0_MAIZE; Transcription factor PCL1 | ||||
TrEMBL | B8A1T5 | 1e-139 | B8A1T5_MAIZE; Uncharacterized protein | ||||
TrEMBL | K7V8Y4 | 1e-139 | K7V8Y4_MAIZE; G2-like transcription factor | ||||
STRING | GRMZM2G067702_P01 | 1e-140 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46640.3 | 2e-59 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G067702_P02 |
Entrez Gene | 100280967 |
Publications ? help Back to Top | |||
---|---|---|---|
|