PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G067702_P01 | ||||||||
Common Name | GLK56, LOC100280967, ZEAMMB73_414660, Zm.15210 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 219aa MW: 23717.8 Da PI: 7.0878 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 97 | 1.3e-30 | 116 | 169 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +prl+Wtp+LH+rFv++v++L G++kA+Pkti+elm+v+gLt+e+v+SHLQkYRl GRMZM2G067702_P01 116 RPRLVWTPQLHKRFVDVVAHL-GIKKAVPKTIMELMNVEGLTRENVASHLQKYRL 169 59*******************.********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.913 | 113 | 172 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.1E-31 | 114 | 174 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.97E-19 | 115 | 173 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.5E-25 | 117 | 169 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 3.3E-8 | 119 | 168 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0042753 | Biological Process | positive regulation of circadian rhythm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MGEEAVDDYE LHMVCYGSDE DERVMEWESG LPGADELTPL SQPLVPPGLA AAFRIPPEPG 60 RTLLDLHRAS EATVARLRRA PPSSPGTSSS PHGHQEARGG EGADSAAATT TNSNRRPRLV 120 WTPQLHKRFV DVVAHLGIKK AVPKTIMELM NVEGLTRENV ASHLQKYRLY VKRMRGQGPS 180 PSDHIFAPTP VHGVAVGMVP MVSGQAYHYL YNGGGGGDR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 3e-33 | 116 | 172 | 1 | 57 | Transcription factor LUX |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.15210 | 0.0 | ovary |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G067702 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00014 | PBM | Transfer from AT3G46640 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G067702_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728053 | 0.0 | KJ728053.1 Zea mays clone pUT6199 G2-like transcription factor (GLK56) gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008654896.1 | 1e-160 | ARR1 protein-like isoform X1 | ||||
Swissprot | Q94DH3 | 4e-80 | PCL1_ORYSJ; Transcription factor PCL1 | ||||
TrEMBL | A0A3L6DQG0 | 1e-159 | A0A3L6DQG0_MAIZE; Transcription factor PCL1 | ||||
TrEMBL | K7V8Y4 | 1e-159 | K7V8Y4_MAIZE; G2-like transcription factor | ||||
STRING | GRMZM2G067702_P01 | 1e-160 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1620 | 34 | 105 | Representative plant | OGRP1157 | 17 | 53 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46640.3 | 7e-62 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G067702_P01 |
Entrez Gene | 100280967 |
Publications ? help Back to Top | |||
---|---|---|---|
|