PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G064744_P01
Common NameLOC100383951
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 362aa    MW: 39215 Da    PI: 6.5023
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G064744_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-161562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  GRMZM2G064744_P01 15 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 62
                       788*******************************************97 PP

2Myb_DNA-binding49.97.2e-1668111146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg+++++E++l+v ++k lG++ W+ Ia+ ++ gRt++++k++w++
  GRMZM2G064744_P01  68 RGSFSQQEEDLIVSLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 111
                        899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9921062IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-231165IPR009057Homeodomain-like
SuperFamilySSF466891.16E-2812109IPR009057Homeodomain-like
SMARTSM007176.8E-131464IPR001005SANT/Myb domain
PfamPF002493.0E-141562IPR001005SANT/Myb domain
CDDcd001671.40E-111862No hitNo description
PROSITE profilePS5129424.90863117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2566117IPR009057Homeodomain-like
SMARTSM007176.5E-1567115IPR001005SANT/Myb domain
PfamPF002493.9E-1468111IPR001005SANT/Myb domain
CDDcd001676.84E-1170110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGREAAATRP PKLRRGLWSP EEDEKLYNHI IRYGVGCWSS VPKLAGLERC GKSCRLRWIN  60
YLRPDLKRGS FSQQEEDLIV SLHKILGNRW SQIASQLPGR TDNEIKNFWN SCIKKKLRQQ  120
GIDPATHKPL NDDDNAAAAA AADNDAAVAP HHHRRHQDDH CGAANIDNNN NNNNNNNNRQ  180
LPSADDHCFA MSSDDPLAPH SPTVSFDPLS VTNVPTAMQQ GSYGSFRSDN DHLCDYGGGG  240
VDVVSDAATA YSAPYTGGGG GGGDSSSNSN GNGTWACSGG EPMPPHVAMF GRDAAQAAAY  300
HQFVDPAKYS PWQQHPAARL HDHNVGGAAA GFPIRSMSRD LPGSCFDLAR SALEDEFSVD  360
FL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31111173108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.344540.0meristem| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G064744
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G064744_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0687120.0BT068712.1 Zea mays full-length cDNA clone ZM_BFb0376H03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001170039.10.0uncharacterized protein LOC100383951
TrEMBLC0PK930.0C0PK93_MAIZE; MYB transcription factor
STRINGGRMZM2G064744_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-72myb domain protein 86