PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G064197_P02 | ||||||||
Common Name | LOC100282824 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 111aa MW: 11982.8 Da PI: 10.6477 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 108.3 | 3.9e-34 | 37 | 91 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWt +LHerFv+av+qLGG+ekAtPktil++m+vkgLtl h+kSHLQkYRl GRMZM2G064197_P02 37 KPRLRWTADLHERFVDAVAQLGGPEKATPKTILRTMGVKGLTLFHLKSHLQKYRL 91 79****************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-32 | 34 | 92 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 11.738 | 34 | 94 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.87E-17 | 36 | 93 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.8E-25 | 37 | 92 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 3.0E-9 | 39 | 90 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009567 | Biological Process | double fertilization forming a zygote and endosperm | ||||
GO:0010628 | Biological Process | positive regulation of gene expression | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MFPPGLIHHR PDATAPGDGP PRSGPGGPSL VLTADPKPRL RWTADLHERF VDAVAQLGGP 60 EKATPKTILR TMGVKGLTLF HLKSHLQKYR LGKQSDKEGS EQSKDGKLLS S |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.117878 | 1e-179 | ear| embryo| endosperm| glume| meristem| root| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G064197 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00378 | DAP | Transfer from AT3G24120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G064197_P02 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT037347 | 1e-177 | BT037347.1 Zea mays full-length cDNA clone ZM_BFb0165E16 mRNA, complete cds. | |||
GenBank | EU962431 | 1e-177 | EU962431.1 Zea mays clone 242603 myb family transcription factor-related protein mRNA, complete cds. | |||
GenBank | KJ726856 | 1e-177 | KJ726856.1 Zea mays clone pUT3396 G2-like transcription factor (GLK1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020403322.1 | 3e-67 | myb family transcription factor-related protein isoform X1 | ||||
Swissprot | Q94A57 | 5e-42 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
TrEMBL | A0A1D6I1M2 | 1e-73 | A0A1D6I1M2_MAIZE; Protein PHR1-LIKE 3 | ||||
STRING | Si030441m | 3e-59 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24120.2 | 8e-43 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G064197_P02 |
Publications ? help Back to Top | |||
---|---|---|---|
|