PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G060834_P01 | ||||||||
Common Name | GLK47, LOC100194380 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 380aa MW: 40092.9 Da PI: 7.8325 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 101.9 | 4.2e-32 | 183 | 236 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ GRMZM2G060834_P01 183 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 236 9****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-28 | 181 | 236 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.87E-15 | 181 | 237 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.6E-23 | 183 | 237 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.0E-7 | 184 | 235 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 380 aa Download sequence Send to blast |
MELFPAHPDL QLQISPPPPA TKPMELGFWK RALVDTTTSP ATATAVAAAT TATTATSHAF 60 ASSAPTSAVG YHHAAVGAHH HQVPVPVPAG SHSHSHLGLP LLHHTHPILP AAESGGVLRR 120 PDLGSTRPIR GIPVYSTSQQ PLPFLQSHPH YCCDAIAGAG HPRSPKAALR LAGAPAKRGA 180 RAPRMRWTTS LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTIKTT 240 DHRPASASSY GQAGGAKTII DIPDDDSSLF DLTNTTTTTS GSESSAQHSN PPDGSEHNGA 300 STCALWCNAS ISGRGAACWF VRDKSRDATP GDIKSFEDVQ SQSLDDDVSD LNLSAPFQVA 360 AATMFGGGNK PNLDFTLGRI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 2e-16 | 184 | 238 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 2e-16 | 184 | 238 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_A | 2e-16 | 184 | 238 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 2e-16 | 184 | 238 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 2e-16 | 184 | 238 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 2e-16 | 184 | 238 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 2e-16 | 184 | 238 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 2e-16 | 184 | 238 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 2e-16 | 184 | 238 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 2e-16 | 184 | 238 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 2e-16 | 184 | 238 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 2e-16 | 184 | 238 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G060834 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G060834_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ726829 | 0.0 | KJ726829.1 Zea mays clone pUT3369 G2-like transcription factor (GLK47) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001132886.1 | 0.0 | uncharacterized protein LOC100194380 | ||||
TrEMBL | A0A3L6EQH8 | 0.0 | A0A3L6EQH8_MAIZE; Putative transcription factor KAN2 | ||||
TrEMBL | B4FIH3 | 0.0 | B4FIH3_MAIZE; G2-like transcription factor | ||||
STRING | GRMZM2G060834_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP9438 | 34 | 45 | Representative plant | OGRP570 | 15 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G32240.1 | 3e-31 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G060834_P01 |
Entrez Gene | 100194380 |