PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G052890_P01

Common Name

ZAG1

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

MIKC_MADS

Protein Properties

Length: 286aa MW: 32175 Da PI: 9.6967

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G052890_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.9	2e-31	61	110	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ GRMZM2G052890_P01 61 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 110 79***********************************************8 PP
2	K-box	97.1	2.6e-32	132	226	7	100
K-box 7 ks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +e + ++++qe+a+L+++i nLq+++R l+G++++++s+keL++Le++L+k+l kiR+kKn++l++++e++q++e elq++n +Lr++ GRMZM2G052890_P01 132 AGtIAEVTIQHYKQESARLRQQIVNLQNSNRALIGDSITTMSHKELKHLETRLDKALGKIRAKKNDVLCSEVEYMQRREMELQNDNLYLRSR 223 445788899*********************************************************************************99 PP K-box 98 lee 100 ++e GRMZM2G052890_P01 224 VDE 226 876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.254	53	113	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.2E-38	53	112	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.22E-43	54	127	No hit	No description
SuperFamily	SSF55455	4.84E-32	54	126	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-31	55	75	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-26	62	109	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-31	75	90	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-31	90	111	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	2.2E-23	140	224	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.642	140	230	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 286 aa Download sequence Send to blast
MHIREEEATP STVTGIMSTL TSAGQQKLKE PISPGGGSAS VAGSAAERNN GGRGKGKTEI 60 KRIENTTNRQ VTFCKRRNGL LKKAYELSVL CDAEVALIVF SSRGRLYEYA NNSVKGTIER 120 YKKATSDNSS AAGTIAEVTI QHYKQESARL RQQIVNLQNS NRALIGDSIT TMSHKELKHL 180 ETRLDKALGK IRAKKNDVLC SEVEYMQRRE MELQNDNLYL RSRVDENERA QQTANMMGAP 240 STSEYQQHGF TPYDPIRSFL QFNIVQQPQF YSQQEDRKDF NDQGGR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6bz1_A	8e-20	54	141	2	89	MEF2 CHIMERA
6bz1_B	8e-20	54	141	2	89	MEF2 CHIMERA
6bz1_C	8e-20	54	141	2	89	MEF2 CHIMERA
6bz1_D	8e-20	54	141	2	89	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.133	0.0	ear\| pericarp

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G052890

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in lodicules, stamens, carpels and ovules during their development. {ECO:0000269\|PubMed:16326928}.
Uniprot	TISSUE SPECIFICITY: Expressed in the lodicule, stamen carpel and ovule primordia.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G052890_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	MZEZAG1A	0.0	L18924.1 Corn ZAG1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001105321.1	0.0	homologue of Arabidopsis gene AGAMOUS
Swissprot	Q2V0P1	1e-122	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A3L6EBJ5	0.0	A0A3L6EBJ5_MAIZE; MADS-box transcription factor 58
TrEMBL	Q41876	0.0	Q41876_MAIZE; ZAG1 protein
STRING	GRMZM2G052890_P01	0.0	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP649	37	144
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	3e-93	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	GRMZM2G052890_P01
Entrez Gene	542244

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758] Schmidt RJ, et al. Identification and molecular characterization of ZAG1, the maize homolog of the Arabidopsis floral homeotic gene AGAMOUS. Plant Cell, 1993. 5(7): p. 729-37 [PMID:8103379]