PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G051256_P01 | ||||||||
Common Name | MYB-IF35 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 345aa MW: 37581.3 Da PI: 4.2977 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.2 | 1.7e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +grWT+eEde l++++k++G g+W++ ++ g+ R++k+c++rw +yl GRMZM2G051256_P01 14 KGRWTKEEDEVLARYIKEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.6 | 1e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ ++eE++ ++++++ lG++ W++Ia +++ gRt++++k++w+++l GRMZM2G051256_P01 67 RGNISEEEEDMIIKLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.3E-22 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.323 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.43E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.56E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.351 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.8E-25 | 65 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.7E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.87E-12 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 345 aa Download sequence Send to blast |
MGRAPCCEKV GLKKGRWTKE EDEVLARYIK EHGEGSWRSL PKNAGLLRCG KSCRLRWINY 60 LRAGLKRGNI SEEEEDMIIK LHATLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRRAADFR 120 DGVVVDIDLS KLPGGGKRRG GRASRGAVVA AAKEKKAKEK DDRGNSKVAE AEQQLRDTED 180 DDGGSVSTPR PQSDDCGTAQ SEEEQAQASA SGLTSDGHGP EEEEEEDPLA LSEEMVSALL 240 APESPKLEVG PDGSCMDSYS GPPSGESGCG SSGPSGDVAQ DLDLDDDKAI MDWDLMGLDI 300 STAGDMWDQL VWDYDETLVT EPEGGEEGHQ QQDDVMSDLF FLDNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 8e-24 | 12 | 115 | 2 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 8e-24 | 12 | 115 | 2 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.13865 | 0.0 | endosperm| meristem| sheath| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G051256 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G051256_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF521880 | 0.0 | AF521880.1 Zea mays R2R3 Myb transcription factor MYB-IF35 mRNA, complete cds. | |||
GenBank | BT039901 | 0.0 | BT039901.1 Zea mays full-length cDNA clone ZM_BFc0050D21 mRNA, complete cds. | |||
GenBank | BT063308 | 0.0 | BT063308.1 Zea mays full-length cDNA clone ZM_BFc0051B20 mRNA, complete cds. | |||
GenBank | BT088200 | 0.0 | BT088200.1 Zea mays full-length cDNA clone ZM_BFc0061H17 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105092.1 | 0.0 | R2R3 Myb transcription factor MYB-IF35 | ||||
Swissprot | P27898 | 5e-73 | MYBP_MAIZE; Myb-related protein P | ||||
TrEMBL | A0A3L6FA18 | 0.0 | A0A3L6FA18_MAIZE; Myb-related protein P | ||||
TrEMBL | Q84U76 | 0.0 | Q84U76_MAIZE; MYB transcription factor | ||||
STRING | GRMZM2G051256_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47460.1 | 5e-69 | myb domain protein 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G051256_P01 |
Entrez Gene | 541969 |