PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G048910_P01 | ||||||||
Common Name | umc2317, Zm.98630 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 278aa MW: 30343.2 Da PI: 5.171 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.5 | 4.2e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv +G +W+ +++ g+ R++k+c++rw +yl GRMZM2G048910_P01 14 KGPWTAEEDQKLVGFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.6 | 1e-16 | 71 | 111 | 5 | 47 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + +E+ l +d+++qlG++ W++Ia+ ++ gRt++++k++w+++ GRMZM2G048910_P01 71 SDDEERLVIDLHAQLGNR-WSKIAAQLP-GRTDNEIKNHWNTH 111 899***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-20 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.905 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.86E-27 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.0E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.61E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.438 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-24 | 63 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.9E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.31E-12 | 71 | 112 | No hit | No description |
Pfam | PF00249 | 2.2E-14 | 71 | 111 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 278 aa Download sequence Send to blast |
MGRQPCCDKV GVKKGPWTAE EDQKLVGFLL THGHCCWRVV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL SDDEERLVID LHAQLGNRWS KIAAQLPGRT DNEIKNHWNT HIRKKLVRMG 120 IDPVTHLPLQ EPPAPAPAPA EQQEQSHRQQ EELQLQELQN GRELIMQEGA GEDDITPMIQ 180 PHEIMPTAAA ASNCGSVSSA HAGSASVVSP SCSSSAVSGV EWPEPMYLLG MDGIMDADWG 240 SLFPDTGAGG GGGGFDLGVD PFDQYPGGGF DQEDDHRI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-29 | 14 | 116 | 7 | 108 | B-MYB |
1gv2_A | 2e-29 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.13893 | 0.0 | embryo| endosperm |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G048910 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269|PubMed:15805488}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269|PubMed:15805488}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G048910_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU951873 | 0.0 | EU951873.1 Zea mays clone 1061835 odorant 1 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001281099.1 | 0.0 | uncharacterized protein LOC100216895 | ||||
Swissprot | Q50EX6 | 5e-83 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | B6SGK8 | 0.0 | B6SGK8_MAIZE; Odorant 1 protein | ||||
TrEMBL | K4JRR3 | 0.0 | K4JRR3_MAIZE; MYB-type transcription factor (Fragment) | ||||
STRING | GRMZM2G048910_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66230.1 | 5e-80 | myb domain protein 20 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G048910_P01 |
Entrez Gene | 100216895 |
Publications ? help Back to Top | |||
---|---|---|---|
|