PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G048582_P01
Common NameLOC100285205, Zm.26819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Nin-like
Protein Properties Length: 872aa    MW: 95613.6 Da    PI: 6.7807
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G048582_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.37.1e-29553604152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek++sl++l++yF++++kdAA++Lgvc+T+LKriCRq+GI RWP+Rkik++
  GRMZM2G048582_P01 553 AEKTVSLQVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGITRWPSRKIKKV 604
                        5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.803543624IPR003035RWP-RK domain
PfamPF020422.4E-25556604IPR003035RWP-RK domain
SuperFamilySSF542771.77E-21763861No hitNo description
Gene3DG3DSA:3.10.20.2405.3E-25771855No hitNo description
SMARTSM006669.9E-21774857IPR000270PB1 domain
PROSITE profilePS5174521.945774857IPR000270PB1 domain
CDDcd064075.83E-38775855No hitNo description
PfamPF005643.1E-15775855IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 872 aa     Download sequence    Send to blast
MQCVRDELCR AGSEESVTCI CMEEGGDPQL PSISVARTTS EGAGAVDLDL LEQLLSGDNG  60
WLEVVSRSPN SVAFPPPSAF FSADATATTV TTTAAPAANA SWLIQTGGAS TPSVRERFSQ  120
ALSYIRDTQS DGDVLVQLWV PVNRDDGKLV LTTSGQPFTL DHRSDSLIRF REVSTKYQFP  180
ADVRSGESPG LPGRVFIGRL PEWSPDIRCF TSYEYARVTD AKYLDVHGTM GLPVFEKRSY  240
SCLGVIELIM TKQKLNFTSE LNTICSALQA VNLRSTEVSS IPRKKFSTAS YKDALPEILE  300
VLRAACLTHK LPLAQTWVTC TQQGKRGSRH SDENYRYCIS TIDEACFVNE AEMRGFHEAC  360
SEHHLLRGEG VAGKALTTNQ PCFLPDIGSS TKLEYPLSHH AKIFRLKGAV AIRLRCTRTG  420
IADFVLEFFL PTDCEALEEQ KTVLDSLSGT MRSVCQTLRV VTDREMEGEA ALEMNELNSF  480
TPPEKDKDEL SFGGNSADRR GASWTSLAGT SQQEPELAAL RMHGTFSPVG QGPSLSGVQA  540
TAEGSKTKRR TKAEKTVSLQ VLRQYFAGSL KDAARSLGVC PTTLKRICRQ HGITRWPSRK  600
IKKVDHSLRK LQQIIDSVHG AETAFQLNTL YKDLTDTSIS SDNNLSGSVT VPPTNQSNLT  660
DFNKHQPHKS SSNMPSTSHS HSSCSHGSQS SPSCSVGATE HAQQGIIDLM KSENPVKDSS  720
IQTMQTENTS LYEHFSVHEA PIDLLQDVTE KANGAHHSSR SLSSPNPKQN TDANMRVKAT  780
FGSEKVRFRL NPECNFQGLK HELAKRLSIV DTNPLVLKYL DDDSEWVLMT CDADLQECLH  840
VYKLADIQTI KISVHLAVSP ATRVTAGHTG LS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.268190.0ear
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G048582
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G048582_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9712710.0EU971271.1 Zea mays clone 360961 NIN-like protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151571.20.0NIN-like protein 1
RefseqXP_008668121.10.0NIN-like protein 1 isoform X1
TrEMBLA0A1D6EUG00.0A0A1D6EUG0_MAIZE; NIN-like protein 1
STRINGGRMZM2G048582_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.21e-177Nin-like family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]