PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G034876_P03 | ||||||||
Common Name | GRF1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 319aa MW: 33171.9 Da PI: 8.5935 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 78.4 | 6.9e-25 | 120 | 164 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+ GRMZM2G034876_P03 120 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 164 79****************************************997 PP | |||||||
2 | QLQ | 63 | 7.9e-22 | 59 | 94 | 2 | 37 |
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 +FT+aQ q+L++Q+l+yKyL+a++PvPp+L+++i++ GRMZM2G034876_P03 59 PFTPAQYQELEQQALIYKYLVAGVPVPPDLVVPIRR 94 9*********************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 3.0E-12 | 58 | 94 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 1.2E-15 | 59 | 93 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 23.459 | 59 | 94 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 25.486 | 120 | 164 | IPR014977 | WRC domain |
Pfam | PF08879 | 3.0E-21 | 121 | 163 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009074 | anatomy | style | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 319 aa Download sequence Send to blast |
MAMPYASLSP AGAADHRSST ATASLVPFCR STPLSAGGGL GEEDAQASAR WPAARPVVPF 60 TPAQYQELEQ QALIYKYLVA GVPVPPDLVV PIRRGLDSLA TRFYGQPTLG YGPYLGRKLD 120 PEPGRCRRTD GKKWRCSKEA APDSKYCERH MHRGRNRSRK PVETQLAPQS QPPAAAAVSA 180 APPLAAAAAA TTNGSGFQNH SLYPAIAGST GGGGGVGGSG NISSPFSSSM GGSSQQPPSS 240 FLGNDTGAGM AMGSASAKQE GQTLRHFFDE WPKARDSWPG LSDETASLAS FPPATQLSMS 300 IPMASSDFSV ASSQSPNDD |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.20603 | 0.0 | meristem| ovary| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G034876 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in developing leaves. {ECO:0000269|PubMed:24854713, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a role in the regulation of cell expansion in developing leaves (PubMed:26036253). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function and the transition between cell division and cell expansion in growing leaves (PubMed:26036253). {ECO:0000269|PubMed:26036253}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G034876_P03 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT036988 | 0.0 | BT036988.1 Zea mays full-length cDNA clone ZM_BFb0150I14 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008680931.1 | 1e-128 | putative growth-regulating factor 1 isoform X1 | ||||
Swissprot | A0A060D764 | 1e-130 | GRF1_MAIZE; Growth-regulating factor 1 | ||||
TrEMBL | B4FIQ0 | 0.0 | B4FIQ0_MAIZE; Uncharacterized protein | ||||
STRING | GRMZM2G034876_P01 | 1e-128 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13960.1 | 2e-48 | growth-regulating factor 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G034876_P03 |
Publications ? help Back to Top | |||
---|---|---|---|
|