PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G032336_P01
Common NameLOC100502366
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CAMTA
Protein Properties Length: 913aa    MW: 101843 Da    PI: 8.4302
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G032336_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1163.82.9e-51331473117
               CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptf 94 
                        +  +rw +++ei+a+L+n++++++++++ ++p sg+++Ly+rk+vr+frkDG++wkkkkdgktv+E+hekLK+g+ e +++yYa++e++p+f
  GRMZM2G032336_P01  33 EAGTRWFRPNEIYAVLANYARFKVHAQPIDKPISGTVVLYDRKVVRNFRKDGHNWKKKKDGKTVQEAHEKLKIGNEEKVHVYYARGEDDPNF 124
                        4479**************************************************************************************** PP

               CG-1  95 qrrcywlLeeelekivlvhylev 117
                         rrcywlL++ele+ivlvhy+++
  GRMZM2G032336_P01 125 FRRCYWLLDKELERIVLVHYRQT 147
                        ********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143772.56727153IPR005559CG-1 DNA-binding domain
SMARTSM010769.8E-6130148IPR005559CG-1 DNA-binding domain
PfamPF038593.4E-4434146IPR005559CG-1 DNA-binding domain
SuperFamilySSF812961.2E-10378464IPR014756Immunoglobulin E-set
PfamPF127965.8E-7556634IPR020683Ankyrin repeat-containing domain
CDDcd002047.43E-15557665No hitNo description
Gene3DG3DSA:1.25.40.209.0E-17558671IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484035.91E-16564671IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029716.52573677IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008811.381606638IPR002110Ankyrin repeat
SMARTSM002481.3E-5606635IPR002110Ankyrin repeat
SMARTSM002482200645674IPR002110Ankyrin repeat
SuperFamilySSF525403.19E-9755822IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.42771793IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.316772801IPR000048IQ motif, EF-hand binding site
PfamPF006120.017774792IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0019794816IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.694795819IPR000048IQ motif, EF-hand binding site
PfamPF006127.3E-4796816IPR000048IQ motif, EF-hand binding site
SMARTSM000157.3875897IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.249877905IPR000048IQ motif, EF-hand binding site
PfamPF006120.12878897IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0020040anatomyleaf base
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 913 aa     Download sequence    Send to blast
MAGGAGGRDP LVASEIHGFL TCADLNFDKL MMEAGTRWFR PNEIYAVLAN YARFKVHAQP  60
IDKPISGTVV LYDRKVVRNF RKDGHNWKKK KDGKTVQEAH EKLKIGNEEK VHVYYARGED  120
DPNFFRRCYW LLDKELERIV LVHYRQTSEE SALPPSHVEA EVAEVPRINM IHYTSSTDSA  180
SAHTELSSSA AAAPEDINSN GGGAVSSETD NQGSSLESFW VDLLESSMKN DTPVDASACG  240
GSLVSNQQTN NGMGDSGNNI LYINATSNAI FSPPTNVVSE AYANPGLSQV SESYFGSLKD  300
QANHAPSLLT SDLDSQSKQH TNSLMKTPVS DNMPNDVPAR QNSLGLWKYL DDDISLDDNP  360
SSGILPTEQV TGEIPFQITE ISSEWAYCTE DTKVLVVGCF HENYRHLAGT NLFCVIGDQC  420
VDANIVQTGV YRFIARPHAP GRVNLYLTLD GKTPISEVLS FHYRMVPDSQ NLAEDEPQKS  480
KLQMQMRLAR LLFTTNKKKI APKLLVEGSK VSNLLSASTE KEWMDLSKFV TDSKGTYVPA  540
TEGLLELVLR NRLQEWLVEK LIEGHKSTGR DDLGQGPIHL CSCLGYTWAI HLFSLSGFSL  600
DFRDSSGWTA LHWAAYCGRE KMVAALLSAG ANPSLVTDPT HDVPGGQTAG DLAAGQGYHG  660
LAAYLSEKGL TAHFEAMSLS KGKRSTSRTE SLKRNTKEFE NLSEQELCLR ESLAAYRNAA  720
DAASNIQAAL RERTLKLQTK AIQLANPEND ASAIVAAMRI QHAYRNYNRK KMMRAAARIQ  780
SHFRTWQIRR NFMNMRRQAI KIQAAYRGHQ VRRQYRKVLW SVGVVEKAIL RWRKKRKGLR  840
GIATGMPVAM ATDAEAASTA EEDYYQVGRQ QAEDRFNRSV VRVQALFRSH RAQQEYRRMK  900
VAHEEAKVEF GRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.266820.0ear| endosperm| meristem| ovary| pedicel| pericarp| pollen| root| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G032336
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds calmodulin in a calcium-dependent manner in vitro. Binds to the DNA consensus sequence 5'-T[AC]CG[CT]GT[GT][GT][GT][GT]T[GT]CG-3'. {ECO:0000269|PubMed:16192280}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G032336_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0879100.0BT087910.1 Zea mays full-length cDNA clone ZM_BFb0305J11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001352474.10.0uncharacterized protein LOC100502366
SwissprotQ7XHR20.0CBT_ORYSJ; Calmodulin-binding transcription activator CBT
TrEMBLA0A1D6IBR40.0A0A1D6IBR4_MAIZE; Calmodulin-binding transcription activator 5
STRINGGRMZM2G032336_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98312933
Representative plantOGRP73511116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16940.10.0calmodulin binding;transcription regulators