PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G031398_P02
Common NameG9008, Zm.11914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Nin-like
Protein Properties Length: 1194aa    MW: 130864 Da    PI: 8.0502
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G031398_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK856.9e-27727777252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+ sl++l+kyFs++++dAA +Lgvc+T+LKriCRq+GI+RWP+Rki+++
  GRMZM2G031398_P02 727 EKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKINKV 777
                        899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052711797IPR003035RWP-RK domain
PfamPF020422.0E-24730777IPR003035RWP-RK domain
SuperFamilySSF542771.23E-229811069No hitNo description
Gene3DG3DSA:3.10.20.2405.8E-219841066No hitNo description
SMARTSM006668.9E-179871069IPR000270PB1 domain
PROSITE profilePS5174522.3369871069IPR000270PB1 domain
PfamPF005641.2E-149891066IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1194 aa     Download sequence    Send to blast
MDIGQGATIL VSAGWLYSPF SSSSPSGRRQ LRRCCWSWAK GGGTDVLPFD FPLAGRSSTS  60
DDRASRRSDL ACWARQEDGA LVRPRAHTPM GDRRTGSRHY ASARTLSVGA PSSSPSRQCG  120
GKILFSQKTV LFFISCPELN TVLQIHISLL GVDKDLCLNE WSKTMDVPTP PNRAGCNSNI  180
SNIGSPMQSF DDPFGGAAMT SFDGYSELSS PSVADHIFSL LNDPSSVQHM FALWSSSGSS  240
PRASAVREDM SFDTYPGPMD VTASLAQRIN SASVFNPTEV DRGLKDSDGL VPNNGSQQGS  300
SIIPRSVGNI LADRMLMALS LFRKSLSDGV LAQVWMPVEH NGRVVLSTSE QPYLLDQDLA  360
GYREVSRNFL FSVKEEPGLH LGLPGRVFIS GVPEWTSSVT YYSKPEYLRM EHALLHEIRG  420
SLAMPVYDPS KGSCCAVLEL VTNKEKPDFD AEMDIGVNLQ TTTDRSNQKV YSENQKYAST  480
EILDVLRAIC HAHMLPLALT WIPTSNGTAN GFCVAKNIRL DSQPGKSVLR IHESACYVND  540
AKMQGFLHAC AERHLEKGQG IAGRALKSNL PFFSPDIREY SIEDYPLAHH ARKFGLHAAV  600
AIRLRSTYTG KDDYILEFFL PVNCKGCGEQ QMLLNSLSST MQRICKSLRT VSEAETDSVS  660
ATEPMYEKTN GSCLPTGNSE SSSHDDQPIT ESAFHDLSSG DKQGDREPAK ARSSSKRVAE  720
KKRSTSEKNF SLDVLRKYFS GSLRDAAMSL GVCPTTLKRI CRQHGISRWP SRKINKVNRS  780
LKKIEKVIKS VHGVDRSLQY DPATGSLVPA TSLPDKMPTS SAGVKTVEEK SSPEPGQDFS  840
SPDGWQRESS QLHASSIPTR VGDEVQMLAI NNEGSRNYAS GIANIAQHSN SEDAHGPLYP  900
VGAVNSSRTG ETGYIDSPTS LHMDSVEGQT TVRDSRSVQQ ADVTMATKEQ TLPSTSGTTD  960
SSSGSASSQP AFKGNPGRAL KVSSSDALTV KATCNGDTVR FKFLPAMGWY HLLEEVAKRF  1020
KLATGAFQLK YKDDEDEWVI LANDADLQEC VDVLDSIGSR SVKLQILFLT NLLVVKPRCD  1080
MALPSRCSHE MLGKNQGEKV GGTSRGRHNN MWRGIGSRGV VAGWHRVEWE MHKKGMEIRR  1140
AQGRRRGQRV RVTQQEARDR DREGSRKMWV VMVKEEGIVG DECFDGLDRG IGQL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.119141e-156embryo| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G031398
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G031398_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277560.0KJ727756.1 Zea mays clone pUT5699 NLP transcription factor (NLP3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669225.10.0protein NLP2
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLQ5GAU40.0Q5GAU4_MAIZE; Uncharacterized protein
STRINGGRMZM2G031398_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-175Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Brunner S,Fengler K,Morgante M,Tingey S,Rafalski A
    Evolution of DNA sequence nonhomologies among maize inbreds.
    Plant Cell, 2005. 17(2): p. 343-60
    [PMID:15659640]