PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G020772_P01 | ||||||||
Common Name | LOC100381953 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 304aa MW: 33419.5 Da PI: 9.988 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25 | 4.4e-08 | 32 | 76 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47 WT+ E +++ +a + l +W+++ar ++ gRt +++s++ ++ GRMZM2G020772_P01 32 WTAAENKQFERALAGLDLCrpDWEKVARAIP-GRTVREVVSHFKSL 76 ****************99999**********.**********9875 PP | |||||||
2 | Myb_DNA-binding | 46 | 1.2e-14 | 143 | 187 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + k++G+g+W+ I+r ++Rt+ q+ s+ qky GRMZM2G020772_P01 143 PWTEEEHRLFLLGLKKYGKGDWRNISRNYVQTRTPTQVASHAQKY 187 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 8.76 | 27 | 81 | IPR017884 | SANT domain |
SMART | SM00717 | 0.016 | 28 | 79 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.24E-6 | 32 | 76 | No hit | No description |
SuperFamily | SSF46689 | 3.01E-8 | 32 | 84 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.9E-5 | 32 | 76 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.711 | 136 | 192 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.28E-18 | 138 | 192 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.6E-17 | 139 | 190 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 6.1E-12 | 140 | 186 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-13 | 140 | 190 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.37E-12 | 143 | 188 | No hit | No description |
Pfam | PF00249 | 3.5E-12 | 143 | 187 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 304 aa Download sequence Send to blast |
MMRETYMDVL PPVDHIAASR SGGWFPGAAR LWTAAENKQF ERALAGLDLC RPDWEKVARA 60 IPGRTVREVV SHFKSLQVDV QQIESGLVPM PVYGAGAGSF TLQWDGCYGP ADSRHNGYRF 120 GSGGCGRRHH GRTPEQDRKK GVPWTEEEHR LFLLGLKKYG KGDWRNISRN YVQTRTPTQV 180 ASHAQKYFIR LNSGGKDKRR SSIHDITTVN LTDDERAPSP SRSSLITTTS QPNAPAPAAA 240 VIGGPFSSAA AAEAKQHQHG AGNLPPNRTS VVPAVYRMDD SQDHGLQCGP LRHQLVASHH 300 SVLF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 4e-14 | 27 | 99 | 6 | 79 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.33016 | 0.0 | ovary| pericarp |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G020772 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G020772_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT062722 | 0.0 | BT062722.1 Zea mays full-length cDNA clone ZM_BFb0338C17 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001168197.1 | 0.0 | uncharacterized LOC100381953 | ||||
Refseq | XP_008673107.1 | 0.0 | putative MYB DNA-binding domain superfamily protein isoform X1 | ||||
Swissprot | Q8S9H7 | 2e-73 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A3L6FG35 | 0.0 | A0A3L6FG35_MAIZE; Transcription factor DIVARICATA | ||||
TrEMBL | C0P353 | 0.0 | C0P353_MAIZE; Duplicated homeodomain-like superfamily protein | ||||
TrEMBL | K4JRL7 | 0.0 | K4JRL7_MAIZE; MYB-type transcription factor (Fragment) | ||||
STRING | GRMZM2G020772_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7886 | 33 | 48 | Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 3e-63 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G020772_P01 |
Entrez Gene | 100381953 |
Publications ? help Back to Top | |||
---|---|---|---|
|