PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G014653_P04
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 84aa    MW: 9207.58 Da    PI: 7.2908
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G014653_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM59.88.9e-191058150
                NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                       lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lp++
  GRMZM2G014653_P04 10 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPST 58
                       79**************************99.88**************943 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-21760IPR003441NAC domain
PROSITE profilePS5100519.7221084IPR003441NAC domain
PfamPF023652.8E-81153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MSGAGPDLQL PPGFRFHPTD EELVMHYLCR RCAGLPIAVP IIAEIDLYKF DPWQLPSTSR  60
RPRSSCSSSS SREPISCAAV TMAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-23459964Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.121134e-92cell culture| meristem| ovary| pedicel| pericarp| pollen| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G014653
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10660065}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G014653_P04
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0543868e-90BT054386.2 Zea mays full-length cDNA clone ZM_BFc0017P07 mRNA, complete cds.
GenBankBT0605348e-90BT060534.2 Zea mays full-length cDNA clone ZM_BFb0012O13 mRNA, complete cds.
GenBankBT0632388e-90BT063238.2 Zea mays full-length cDNA clone ZM_BFc0041I22 mRNA, complete cds.
GenBankBT0644058e-90BT064405.1 Zea mays full-length cDNA clone ZM_BFc0166H07 mRNA, complete cds.
GenBankBT0650828e-90BT065082.2 Zea mays full-length cDNA clone ZM_BFb0054J18 mRNA, complete cds.
GenBankBT0676178e-90BT067617.2 Zea mays full-length cDNA clone ZM_BFc0107G18 mRNA, complete cds.
GenBankBT0692918e-90BT069291.2 Zea mays full-length cDNA clone ZM_BFc0043P04 mRNA, complete cds.
GenBankBT0853758e-90BT085375.2 Zea mays full-length cDNA clone ZM_BFc0005B20 mRNA, complete cds.
GenBankBT0858928e-90BT085892.2 Zea mays full-length cDNA clone ZM_BFc0076P05 mRNA, complete cds.
GenBankEU9562428e-90EU956242.1 Zea mays clone 1559533 NAC domain-containing protein 48 mRNA, complete cds.
GenBankHQ8587138e-90HQ858713.1 Zea mays clone UT1169 NAC transcription factor mRNA, partial cds.
GenBankKP2979318e-90KP297931.1 UNVERIFIED: Zea mays Zma003086-like mRNA, complete sequence.
GenBankKP9007668e-90KP900766.1 Zea mays NAC protein Zma3086 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266607.21e-34NAC domain-containing protein 48
SwissprotQ7F2L33e-32NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLC0P7Y62e-34C0P7Y6_MAIZE; Uncharacterized protein
STRINGGRMZM2G014653_P015e-34(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-27NAC family protein
Publications ? help Back to Top
  1. Xiong L,Lee MW,Qi M,Yang Y
    Identification of defense-related rice genes by suppression subtractive hybridization and differential screening.
    Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92
    [PMID:11332734]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Ohnishi T, et al.
    OsNAC6, a member of the NAC gene family, is induced by various stresses in rice.
    Genes Genet. Syst., 2005. 80(2): p. 135-9
    [PMID:16172526]
  4. Hu H, et al.
    Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice.
    Plant Mol. Biol., 2008. 67(1-2): p. 169-81
    [PMID:18273684]
  5. Kim MJ, et al.
    Quadruple 9-mer-based protein binding microarray with DsRed fusion protein.
    BMC Mol. Biol., 2009. 10: p. 91
    [PMID:19761621]
  6. Chung PJ,Kim JK
    Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth.
    Plant Signal Behav, 2009. 4(7): p. 675-7
    [PMID:19820307]
  7. Peng HF, et al.
    Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.).
    Theor. Appl. Genet., 2010. 120(5): p. 1013-20
    [PMID:20012261]
  8. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  9. Kim MJ, et al.
    Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein.
    Methods Mol. Biol., 2012. 786: p. 65-77
    [PMID:21938620]
  10. Gupta SK, et al.
    The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice.
    J. Exp. Bot., 2012. 63(2): p. 757-72
    [PMID:22058403]
  11. Nakashima K, et al.
    Comparative functional analysis of six drought-responsive promoters in transgenic rice.
    Planta, 2014. 239(1): p. 47-60
    [PMID:24062085]
  12. Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice.
    Rice (N Y), 2012. 5(1): p. 6
    [PMID:24764506]
  13. Qian B, et al.
    Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+).
    J. Plant Physiol., 2015. 175: p. 9-20
    [PMID:25460871]
  14. Shiriga K, et al.
    Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize.
    Meta Gene, 2014. 2: p. 407-17
    [PMID:25606426]
  15. Farooq MA,Detterbeck A,Clemens S,Dietz KJ
    Silicon-induced reversibility of cadmium toxicity in rice.
    J. Exp. Bot., 2016. 67(11): p. 3573-85
    [PMID:27122572]
  16. Lee DK, et al.
    The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance.
    Plant Biotechnol. J., 2017. 15(6): p. 754-764
    [PMID:27892643]