PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G014653_P03
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 202aa    MW: 22923.6 Da    PI: 10.6113
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G014653_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.3e-51101341128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v
  GRMZM2G014653_P03  10 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGAGYWKATGADKPV 100
                        79**************************99.88***************7666789************************************* PP

                NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +   +   +kk Lvfy g+apkgekt+W+mheyrl
  GRMZM2G014653_P03 101 GT--PKPLAIKKALVFYAGKAPKGEKTNWIMHEYRL 134
                        99..7789**************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-567137IPR003441NAC domain
PROSITE profilePS5100554.30910182IPR003441NAC domain
PfamPF023652.4E-2611134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MSGAGPDLQL PPGFRFHPTD EELVMHYLCR RCAGLPIAVP IIAEIDLYKF DPWQLPRMAL  60
YGEKEWYFFS PRDRKYPNGS RPNRAAGAGY WKATGADKPV GTPKPLAIKK ALVFYAGKAP  120
KGEKTNWIMH EYRLADVDRS ARKKNSLRVR TSAPPPSVRP LASSPSKSNK KNLAIMCRFR  180
NERGDKRGPW FWAAEFFLRG PC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-6941349140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.121130.0cell culture| meristem| ovary| pedicel| pericarp| pollen| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G014653
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10660065}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G014653_P03
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0644050.0BT064405.1 Zea mays full-length cDNA clone ZM_BFc0166H07 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266607.21e-104NAC domain-containing protein 48
SwissprotQ7F2L31e-101NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLC0P7Y61e-146C0P7Y6_MAIZE; Uncharacterized protein
STRINGGRMZM2G014653_P011e-104(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.15e-93NAC family protein
Publications ? help Back to Top
  1. Xiong L,Lee MW,Qi M,Yang Y
    Identification of defense-related rice genes by suppression subtractive hybridization and differential screening.
    Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92
    [PMID:11332734]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Ohnishi T, et al.
    OsNAC6, a member of the NAC gene family, is induced by various stresses in rice.
    Genes Genet. Syst., 2005. 80(2): p. 135-9
    [PMID:16172526]
  4. Hu H, et al.
    Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice.
    Plant Mol. Biol., 2008. 67(1-2): p. 169-81
    [PMID:18273684]
  5. Kim MJ, et al.
    Quadruple 9-mer-based protein binding microarray with DsRed fusion protein.
    BMC Mol. Biol., 2009. 10: p. 91
    [PMID:19761621]
  6. Chung PJ,Kim JK
    Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth.
    Plant Signal Behav, 2009. 4(7): p. 675-7
    [PMID:19820307]
  7. Peng HF, et al.
    Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.).
    Theor. Appl. Genet., 2010. 120(5): p. 1013-20
    [PMID:20012261]
  8. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  9. Kim MJ, et al.
    Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein.
    Methods Mol. Biol., 2012. 786: p. 65-77
    [PMID:21938620]
  10. Gupta SK, et al.
    The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice.
    J. Exp. Bot., 2012. 63(2): p. 757-72
    [PMID:22058403]
  11. Nakashima K, et al.
    Comparative functional analysis of six drought-responsive promoters in transgenic rice.
    Planta, 2014. 239(1): p. 47-60
    [PMID:24062085]
  12. Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice.
    Rice (N Y), 2012. 5(1): p. 6
    [PMID:24764506]
  13. Qian B, et al.
    Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+).
    J. Plant Physiol., 2015. 175: p. 9-20
    [PMID:25460871]
  14. Shiriga K, et al.
    Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize.
    Meta Gene, 2014. 2: p. 407-17
    [PMID:25606426]
  15. Farooq MA,Detterbeck A,Clemens S,Dietz KJ
    Silicon-induced reversibility of cadmium toxicity in rice.
    J. Exp. Bot., 2016. 67(11): p. 3573-85
    [PMID:27122572]
  16. Lee DK, et al.
    The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance.
    Plant Biotechnol. J., 2017. 15(6): p. 754-764
    [PMID:27892643]