PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G014653_P03 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 202aa MW: 22923.6 Da PI: 10.6113 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 164.3 | 4.3e-51 | 10 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrFhPtdeelv++yL+++++g ++ + +i+e+d+yk++Pw+Lp+++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v GRMZM2G014653_P03 10 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGAGYWKATGADKPV 100 79**************************99.88***************7666789************************************* PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + + +kk Lvfy g+apkgekt+W+mheyrl GRMZM2G014653_P03 101 GT--PKPLAIKKALVFYAGKAPKGEKTNWIMHEYRL 134 99..7789**************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-56 | 7 | 137 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.309 | 10 | 182 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.4E-26 | 11 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MSGAGPDLQL PPGFRFHPTD EELVMHYLCR RCAGLPIAVP IIAEIDLYKF DPWQLPRMAL 60 YGEKEWYFFS PRDRKYPNGS RPNRAAGAGY WKATGADKPV GTPKPLAIKK ALVFYAGKAP 120 KGEKTNWIMH EYRLADVDRS ARKKNSLRVR TSAPPPSVRP LASSPSKSNK KNLAIMCRFR 180 NERGDKRGPW FWAAEFFLRG PC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 6e-69 | 4 | 134 | 9 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.12113 | 0.0 | cell culture| meristem| ovary| pedicel| pericarp| pollen| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G014653 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10660065}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00121 | DAP | Transfer from AT1G01720 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G014653_P03 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT064405 | 0.0 | BT064405.1 Zea mays full-length cDNA clone ZM_BFc0166H07 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001266607.2 | 1e-104 | NAC domain-containing protein 48 | ||||
Swissprot | Q7F2L3 | 1e-101 | NAC48_ORYSJ; NAC domain-containing protein 48 | ||||
TrEMBL | C0P7Y6 | 1e-146 | C0P7Y6_MAIZE; Uncharacterized protein | ||||
STRING | GRMZM2G014653_P01 | 1e-104 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01720.1 | 5e-93 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G014653_P03 |