Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 162.9 | 1.2e-50 | 10 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92
lppGfrFhPtdeelv++yL+++++g ++ + +i+e+d+yk++Pw+Lp+++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v
GRMZM2G014653_P01 10 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGAGYWKATGADKPV 100
79**************************99.88***************7666789************************************* PP
NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+ + +kk Lvfy g+apkgekt+W+mheyrl
GRMZM2G014653_P01 101 GT--PKPLAIKKALVFYAGKAPKGEKTNWIMHEYRL 134
99..7789**************************98 PP
|
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | BT054386 | 0.0 | BT054386.2 Zea mays full-length cDNA clone ZM_BFc0017P07 mRNA, complete cds. |
GenBank | BT060534 | 0.0 | BT060534.2 Zea mays full-length cDNA clone ZM_BFb0012O13 mRNA, complete cds. |
GenBank | BT063238 | 0.0 | BT063238.2 Zea mays full-length cDNA clone ZM_BFc0041I22 mRNA, complete cds. |
GenBank | BT067617 | 0.0 | BT067617.2 Zea mays full-length cDNA clone ZM_BFc0107G18 mRNA, complete cds. |
GenBank | BT069291 | 0.0 | BT069291.2 Zea mays full-length cDNA clone ZM_BFc0043P04 mRNA, complete cds. |
GenBank | BT085375 | 0.0 | BT085375.2 Zea mays full-length cDNA clone ZM_BFc0005B20 mRNA, complete cds. |
GenBank | BT085892 | 0.0 | BT085892.2 Zea mays full-length cDNA clone ZM_BFc0076P05 mRNA, complete cds. |
GenBank | EU956242 | 0.0 | EU956242.1 Zea mays clone 1559533 NAC domain-containing protein 48 mRNA, complete cds. |
GenBank | KP900766 | 0.0 | KP900766.1 Zea mays NAC protein Zma3086 mRNA, complete cds. |
Publications
? help Back to Top |
- Xiong L,Lee MW,Qi M,Yang Y
Identification of defense-related rice genes by suppression subtractive hybridization and differential screening. Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92 [PMID:11332734] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Ohnishi T, et al.
OsNAC6, a member of the NAC gene family, is induced by various stresses in rice. Genes Genet. Syst., 2005. 80(2): p. 135-9 [PMID:16172526] - Hu H, et al.
Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice. Plant Mol. Biol., 2008. 67(1-2): p. 169-81 [PMID:18273684] - Alexandrov NN, et al.
Insights into corn genes derived from large-scale cDNA sequencing. Plant Mol. Biol., 2009. 69(1-2): p. 179-94 [PMID:18937034] - Kim MJ, et al.
Quadruple 9-mer-based protein binding microarray with DsRed fusion protein. BMC Mol. Biol., 2009. 10: p. 91 [PMID:19761621] - Chung PJ,Kim JK
Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth. Plant Signal Behav, 2009. 4(7): p. 675-7 [PMID:19820307] - Peng HF, et al.
Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.). Theor. Appl. Genet., 2010. 120(5): p. 1013-20 [PMID:20012261] - Takasaki H, et al.
The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] - Kim MJ, et al.
Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein. Methods Mol. Biol., 2012. 786: p. 65-77 [PMID:21938620] - Gupta SK, et al.
The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice. J. Exp. Bot., 2012. 63(2): p. 757-72 [PMID:22058403] - Nakashima K, et al.
Comparative functional analysis of six drought-responsive promoters in transgenic rice. Planta, 2014. 239(1): p. 47-60 [PMID:24062085] - Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice. Rice (N Y), 2012. 5(1): p. 6 [PMID:24764506] - Qian B, et al.
Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+). J. Plant Physiol., 2015. 175: p. 9-20 [PMID:25460871] - Shiriga K, et al.
Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize. Meta Gene, 2014. 2: p. 407-17 [PMID:25606426] - Lu M,Sun QP,Zhang DF,Wang TY,Pan JB
Identification of 7 stress-related NAC transcription factor members in maize (Zea mays L.) and characterization of the expression pattern of these genes. Biochem. Biophys. Res. Commun., 2015. 462(2): p. 144-50 [PMID:25937463] - Farooq MA,Detterbeck A,Clemens S,Dietz KJ
Silicon-induced reversibility of cadmium toxicity in rice. J. Exp. Bot., 2016. 67(11): p. 3573-85 [PMID:27122572] - Lee DK, et al.
The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance. Plant Biotechnol. J., 2017. 15(6): p. 754-764 [PMID:27892643]
|