PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G012717_P01
Common NameCOL10, Zm.35863
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CO-like
Protein Properties Length: 452aa    MW: 48379.9 Da    PI: 5.071
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G012717_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.36.7e-082162338
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                       +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  GRMZM2G012717_P01 21 ARACDGCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 62
                       578*****************************6567777776 PP

2CCT67.73.1e-23397440144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  GRMZM2G012717_P01 397 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 440
                        9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.2E-111966IPR000315B-box-type zinc finger
PROSITE profilePS5011910.481966IPR000315B-box-type zinc finger
PfamPF006431.3E-62263IPR000315B-box-type zinc finger
CDDcd000212.59E-82466No hitNo description
PROSITE profilePS5101716.083397439IPR010402CCT domain
PfamPF062037.7E-18397439IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MIATTRGSSA KAAAAVGGKA ARACDGCLRR RARWYCAADD AFLCQGCDTS VHSANPLARR  60
HERLRLCPAS PLQTPPDRSA AAAATATNKR ERHDEVAVPA WFGRKARTPR GGHAKSVGQV  120
ALSRRLVVPH AAGGDSDSPD ERNGGEEEQL LYRVPILDPA LAEFCSPPPL EDAAGLALDA  180
SVCNEDGAIE DPAKPDPAAP LAQFCPVSGH FNFGPTDAEL REFAADMEAL LGHGLDDGNE  240
EDSSFYMETL GLLDPMEVGD DATQVKVETD GSSACCEASG TLACGLELDL EASDEMLDID  300
FDYASPQDTA TDERAASSDT GADAQFLQTS LSLTLNYEAI IQSWGSSPWT GGGERPHVKL  360
DTRWPHDYTN MWVVGGVVGH GGEDLPGTPR LGMDGGREAR VSRYREKRRT RLFSKKIRYE  420
VRKLNAEKRP RMKGRFVKRA TAGGSLAIAG LA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1407423RRTRLFSKKIRYEVRKL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G012717
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G012717_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0638060.0BT063806.1 Zea mays full-length cDNA clone ZM_BFc0109I10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140584.10.0uncharacterized protein LOC100272654
TrEMBLC0P6870.0C0P687_MAIZE; C2C2-CO-like transcription factor
STRINGGRMZM2G012717_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058
Representative plantOGRP8021649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.19e-73B-box type zinc finger protein with CCT domain