PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G012262_P01
Common Namepco123181a, ZEAMMB73_984648
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Whirly
Protein Properties Length: 274aa    MW: 29619.7 Da    PI: 10.3152
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G012262_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly185.97.2e-58962322138
             Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrka 93 
                        v+k+kaal++++++p+f++l+sg  +++++G+++l++ +a+++rkyd+ kkq fals+tev++l++l++ esceffhdp++k+sneG+v+k+
  GRMZM2G012262_P01  96 VFKGKAALSIHPILPSFSKLESGGSRVSKNGSVMLTFFPAVGQRKYDYTKKQLFALSPTEVGSLISLGPAESCEFFHDPSMKSSNEGTVKKS 187
                        9******************************************************************************************* PP

             Whirly  94 lkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                        l++ Pl   sG+fvn++v ns  ++n+++svP++kaefav+r+ l
  GRMZM2G012262_P01 188 LSITPLGSDSGYFVNITVVNSAERTNDRLSVPITKAEFAVIRTTL 232
                        ******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.5E-7283251IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-6987274IPR009044ssDNA-binding transcriptional regulator
PfamPF085368.9E-5796230IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0009074anatomystyle
PO:0020040anatomyleaf base
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MIAHFLGFGA SVGRNSLAPS PPPVRGARSV HLGRGDLRGD ETMLRLSRFL PSACRRGFDL  60
KESLWSGSLT FQQAVSTAAT NLDGNLSGKK FASYTVFKGK AALSIHPILP SFSKLESGGS  120
RVSKNGSVML TFFPAVGQRK YDYTKKQLFA LSPTEVGSLI SLGPAESCEF FHDPSMKSSN  180
EGTVKKSLSI TPLGSDSGYF VNITVVNSAE RTNDRLSVPI TKAEFAVIRT TLSFALPHIM  240
GWDQALTNHH PAPAPPASSR PTVERPHPDS EWER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A2e-72872498169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_B2e-72872498169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_C2e-72872498169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_D2e-72872498169Single-stranded DNA-binding protein WHY2, mitochondrial
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.847320.0ear| embryo| endosperm| meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G012262
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G012262_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9762720.0EU976272.1 Zea mays clone 695581 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152589.21e-170uncharacterized protein LOC100286229
SwissprotD9J0345e-75WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A3L6F8840.0A0A3L6F884_MAIZE; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLK7UBM60.0K7UBM6_MAIZE; DNA binding protein isoform 1
STRINGGRMZM2G012262_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Representative plantOGRP23161635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.17e-74WHIRLY 2