PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G009892_P04 | ||||||||
Common Name | LOC100284412, Zm.139631 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 165aa MW: 18511.2 Da PI: 10.0632 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174.5 | 3e-54 | 11 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrFhPtdeel+++yL++k+++ ++ + +++e+d++k+ePwdLp+ ++ +ekewyfF+ +d+ky+tg r+nrat++gyWkatgkd++v GRMZM2G009892_P04 11 LPPGFRFHPTDEELITHYLARKAADARFAA-LAVAEADLNKCEPWDLPSLARMGEKEWYFFCLKDRKYPTGLRTNRATEAGYWKATGKDRDV 101 79*************************999.67***************8778899************************************* PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +++lvg kktLvfy+grap+gek+ Wvmheyrl GRMZM2G009892_P04 102 FR-GKALVGSKKTLVFYTGRAPRGEKSGWVMHEYRL 136 **.99*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.57E-59 | 7 | 145 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.635 | 11 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.4E-29 | 12 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MEQEPHRPME LPPGFRFHPT DEELITHYLA RKAADARFAA LAVAEADLNK CEPWDLPSLA 60 RMGEKEWYFF CLKDRKYPTG LRTNRATEAG YWKATGKDRD VFRGKALVGS KKTLVFYTGR 120 APRGEKSGWV MHEYRLHAKL HGHGHGHGQG AAVVVVPKAA GTKVG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-51 | 2 | 136 | 8 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-51 | 2 | 136 | 8 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-51 | 2 | 136 | 8 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-51 | 2 | 136 | 8 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
3swm_B | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
3swm_C | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
3swm_D | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
3swp_A | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
3swp_B | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
3swp_C | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
3swp_D | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
4dul_A | 1e-51 | 2 | 136 | 8 | 142 | NAC domain-containing protein 19 |
4dul_B | 1e-51 | 2 | 136 | 8 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.29227 | 0.0 | endosperm |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G009892 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G009892_P04 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT060770 | 0.0 | BT060770.2 Zea mays full-length cDNA clone ZM_BFb0046M18 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001150779.2 | 1e-117 | NAC domain protein NAC5 | ||||
Refseq | XP_020403374.1 | 1e-117 | NAC domain protein NAC5 isoform X1 | ||||
Swissprot | Q9FLJ2 | 7e-76 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | C0P5H4 | 1e-116 | C0P5H4_MAIZE; NAC domain-containing protein 79 | ||||
TrEMBL | K0DFF7 | 1e-116 | K0DFF7_MAIZE; NAC32 NAC type transcription factor (Fragment) | ||||
STRING | GRMZM2G009892_P03 | 1e-117 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61430.1 | 2e-68 | NAC domain containing protein 100 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G009892_P04 |
Entrez Gene | 100284412 |
Publications ? help Back to Top | |||
---|---|---|---|
|