PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G005155_P01 | ||||||||
Common Name | LOC100272346 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 256aa MW: 29155.3 Da PI: 8.6592 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.2 | 7.7e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien +nrqvtfskRr g++KKA+EL +LCda++ viifs +g++yeyss GRMZM2G005155_P01 9 KKIENPTNRQVTFSKRRMGLFKKANELAILCDAQIGVIIFSGSGRMYEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 45 | 4.7e-16 | 85 | 158 | 14 | 87 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 +++ qe++++k+e + L+ +++ edL s s ++L +Leqq+e sl k+R +K+ell +q+ e ++e + GRMZM2G005155_P01 85 QQKIVQEMTRMKDERNRLRMIMAQYMAEDLASFSAQDLSNLEQQIEFSLYKVRLRKQELLDQQLLEIHQREMHM 158 68999**************************************************************9999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.357 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.4E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 9.42E-30 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.38E-39 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 1.4E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.8E-14 | 81 | 161 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.811 | 85 | 186 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 256 aa Download sequence Send to blast |
MGRGKVELKK IENPTNRQVT FSKRRMGLFK KANELAILCD AQIGVIIFSG SGRMYEYSSP 60 PWRIASVFDR YLKAPSTRFE EMDIQQKIVQ EMTRMKDERN RLRMIMAQYM AEDLASFSAQ 120 DLSNLEQQIE FSLYKVRLRK QELLDQQLLE IHQREMHMPA EQGGYLCLMN PAAAIASGQH 180 QQAGEMVGIN PRPFPWWDVG ASGSGSGSQS QQQLLHGRDA AESSMTALGL SPQLHGYRLQ 240 PRQPNLQQDA DIHGWL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 9e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_B | 9e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_C | 9e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_D | 9e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_A | 9e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_B | 9e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_C | 9e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_D | 9e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.12001 | 0.0 | meristem| pericarp| root| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G005155 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G005155_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT038532 | 0.0 | BT038532.1 Zea mays full-length cDNA clone ZM_BFb0284C04 mRNA, complete cds. | |||
GenBank | BT069133 | 0.0 | BT069133.1 Zea mays full-length cDNA clone ZM_BFb0202H05 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001140301.1 | 0.0 | uncharacterized protein LOC100272346 | ||||
Refseq | XP_008667414.1 | 0.0 | MADS transcription factor isoform X1 | ||||
Swissprot | Q84NC2 | 9e-90 | MAD31_ORYSJ; MADS-box transcription factor 31 | ||||
TrEMBL | B4FN44 | 0.0 | B4FN44_MAIZE; MADS transcription factor | ||||
STRING | GRMZM2G005155_P03 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1850 | 37 | 100 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 1e-41 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G005155_P01 |
Entrez Gene | 100272346 |
Publications ? help Back to Top | |||
---|---|---|---|
|