PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G003489_P03 | ||||||||
Common Name | Zm.41316 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 117aa MW: 12899.5 Da PI: 4.1824 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 77.1 | 3e-24 | 53 | 111 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d+++++++sw g+sfvv+d + fa +Lp+yFkhsnf+SFvRQLn+Y GRMZM2G003489_P03 53 FLTKTYDVVDDPNTDTIVSWGFAGTSFVVWDANAFALVILPRYFKHSNFSSFVRQLNTY 111 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 4.0E-25 | 47 | 111 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 2.8E-18 | 49 | 117 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 6.94E-22 | 49 | 112 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 4.2E-20 | 53 | 111 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-14 | 53 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-14 | 91 | 103 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-14 | 104 | 116 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MDPFHGIVKE EFDLDFDFTC ASAAAAAAAS WAVALPEMPR PMEGLGEVGP TPFLTKTYDV 60 VDDPNTDTIV SWGFAGTSFV VWDANAFALV ILPRYFKHSN FSSFVRQLNT YVRVQEG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 4e-18 | 44 | 117 | 17 | 98 | Heat shock factor protein 1 |
5d5v_B | 4e-18 | 44 | 117 | 17 | 98 | Heat shock factor protein 1 |
5d5v_D | 4e-18 | 44 | 117 | 17 | 98 | Heat shock factor protein 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.41316 | 0.0 | endosperm |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G003489 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G003489_P03 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Not induced by heat stress. {ECO:0000269|PubMed:18064488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT085816 | 0.0 | BT085816.2 Zea mays full-length cDNA clone ZM_BFc0067H20 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001335364.1 | 3e-76 | uncharacterized protein LOC109621226 | ||||
Refseq | XP_020395790.1 | 3e-76 | uncharacterized protein LOC109621226 isoform X1 | ||||
Swissprot | Q84MN7 | 8e-49 | HFA2A_ORYSJ; Heat stress transcription factor A-2a | ||||
TrEMBL | A0A1D6L3W5 | 7e-75 | A0A1D6L3W5_MAIZE; Heat stress transcription factor A-6b | ||||
TrEMBL | A0A317YJD5 | 7e-75 | A0A317YJD5_MAIZE; Heat stress transcription factor A-2a | ||||
STRING | Si036148m | 3e-55 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26150.1 | 2e-35 | heat shock transcription factor A2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G003489_P03 |
Publications ? help Back to Top | |||
---|---|---|---|
|