PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G000686_P05 | ||||||||
Common Name | umc1568 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 220aa MW: 24159.8 Da PI: 9.7475 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 107.2 | 1.4e-33 | 112 | 168 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq Rakle+e+kl ksrkpylheSRh hA++R+Rg+gGrF GRMZM2G000686_P05 112 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHLHAMKRARGTGGRF 168 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.1E-38 | 110 | 171 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 39.221 | 111 | 171 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 6.1E-29 | 113 | 168 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.1E-24 | 114 | 136 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 116 | 136 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.1E-24 | 145 | 168 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MRQNGAVMIQ FGHQMPDYDS PATQSTSETS HQEASGMSEG SLNEHNNDHS GNLDGYSKSD 60 ENKMMSALSL GNPETAYAHN PKPDRTQSFM HPQLVGMVPS SRVPLPIEPA AEEPIYVNAK 120 QYHAILRRRQ LRAKLEAENK LVKSRKPYLH ESRHLHAMKR ARGTGGRFLN TKQQPESPGS 180 GGSSDAQRVP ATASGGLFTK HEHSLPPGGR HHYHARGGGE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-23 | 112 | 180 | 2 | 74 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.85146 | 0.0 | ear| embryo| endosperm| meristem| pollen| shoot| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G000686 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G000686_P05 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU953946 | 0.0 | EU953946.1 Zea mays clone 1450156 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008664550.1 | 1e-162 | NF-YA1 isoform X4 | ||||
Swissprot | Q9LVJ7 | 2e-41 | NFYA6_ARATH; Nuclear transcription factor Y subunit A-6 | ||||
TrEMBL | B6TQI5 | 1e-155 | B6TQI5_MAIZE; NF-YA1 | ||||
STRING | GRMZM2G000686_P04 | 1e-153 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G14020.1 | 7e-40 | nuclear factor Y, subunit A6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G000686_P05 |
Entrez Gene | 100194365 |
Publications ? help Back to Top | |||
---|---|---|---|
|