PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC234203.1_FGP011
Common NameZm.30158
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family EIL
Protein Properties Length: 632aa    MW: 69195.8 Da    PI: 6.023
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC234203.1_FGP011genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3416.62.8e-127403791341
                        XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
               EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                        +el +rmwkd+++lkr++er+++l  ++  +++++k++k+++qa rkkm raQDgiLkYMlk mevcna+GfvYgiipekgkpv+gasd++r
  AC234203.1_FGP011  40 DELARRMWKDKVKLKRIRERQQKLALQRL-ELEKTKTKKISDQALRKKMTRAQDGILKYMLKLMEVCNARGFVYGIIPEKGKPVSGASDNIR 130
                        79********************9775555.5************************************************************* PP

                        XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHH CS
               EIN3  93 aWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgel 184
                        aWWk+kv+fd+ngpaai+ky+ +n +ls+ ++    + + +hsl++lqD tlgSLLsalmqhc+p+qr++pl+kgv+pPWWPtG+e ww++l
  AC234203.1_FGP011 131 AWWKDKVKFDKNGPAAIVKYELENSMLSNPKGG---GAMDQHSLMDLQDGTLGSLLSALMQHCSPQQRSYPLDKGVPPPWWPTGNESWWPAL 219
                        ****************************99999...88****************************************************** PP

                        T--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX....XXXXX CS
               EIN3 185 glskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss....slrkq 270
                        gl+k    ppy+kphdlkk+wkv+vLt vikhm+p++++ir+++r+sk+lqdkm+akes ++l vl++eek ++ + +   ++    s++++
  AC234203.1_FGP011 220 GLPKGEA-PPYRKPHDLKKVWKVGVLTGVIKHMAPNFDKIRNRVRKSKCLQDKMTAKESLIWLGVLQREEKSVHGFGSAllQNarhsSTSED 310
                        ****998.9***************************************************************99887776522456577779 PP

                        XXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX............XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXX CS
               EIN3 271 spkvtlsceqkedvegkkeskikhvqavktta............gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetel 341
                        +++ ++s+++++dv+  +++  ++++++++ +            ++  ++kr++                + s+q+  s+ e+
  AC234203.1_FGP011 311 RNEGIYSSSDEYDVDRLEQPPRSTSSKEDEGDaqpvlqirgeqtSTRGTNKRRR--------------HDTSSNQLAISKEEM 379
                        9999***********666665577777777773445555544432222222222..............233333333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.3E-12440288No hitNo description
Gene3DG3DSA:1.10.3180.102.9E-68165292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.54E-60168289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MLDHLAIIAS ELGDDATDFE VDGIDNLSEN DVSDEEIDAD ELARRMWKDK VKLKRIRERQ  60
QKLALQRLEL EKTKTKKISD QALRKKMTRA QDGILKYMLK LMEVCNARGF VYGIIPEKGK  120
PVSGASDNIR AWWKDKVKFD KNGPAAIVKY ELENSMLSNP KGGGAMDQHS LMDLQDGTLG  180
SLLSALMQHC SPQQRSYPLD KGVPPPWWPT GNESWWPALG LPKGEAPPYR KPHDLKKVWK  240
VGVLTGVIKH MAPNFDKIRN RVRKSKCLQD KMTAKESLIW LGVLQREEKS VHGFGSALLQ  300
NARHSSTSED RNEGIYSSSD EYDVDRLEQP PRSTSSKEDE GDAQPVLQIR GEQTSTRGTN  360
KRRRHDTSSN QLAISKEEMS KSKSQQRKGP STRPPVAEVE VEVTQRNDKT PEVVCSAAGG  420
DMNFIDPIDA VGITNLPMSP KHVPPTIGAL QQHGDCRGNF LSPAAAINYN SSNSNQAASA  480
AQSNTYLGGH PLACEGSDIA NSWSGHSFQQ DVGLGPPIGF DPSPVAHQGS AVQQPLPLPL  540
PLPMDHQAPI TGSGALATNG SYSLPTAGGV SSGTIVSETH QQLMDNPFFG DAGDSSFGGL  600
PFSLLPFSSP MLNFDELDEL VDDDDLMQYL GT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A5e-601682959136ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.301580.0shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC234203.1_FG011
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC234203.1_FGP011
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0883790.0BT088379.1 Zea mays full-length cDNA clone ZM_BFc0165A14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151957.10.0ethylene-insensitive3-like protein
SwissprotO231161e-135EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A317Y3M10.0A0A317Y3M1_MAIZE; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLC4JC320.0C4JC32_MAIZE; ETHYLENE INSENSITIVE 3-like 3 protein
STRINGAC234203.1_FGP0110.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-137ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  2. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  3. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  4. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]