PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC233865.1_FGP003
Common NameLOC103633138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 245aa    MW: 27690 Da    PI: 5.2018
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC233865.1_FGP003genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.63.5e-5561341128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                        lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd+
  AC233865.1_FGP003   6 LPPGFRFHPTDEELVNYYLKRKIHGLKIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDR 96 
                        79****************************.99**************85335566888********************************** PP

                NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +vl+++g+ +g+kktLv+y+grap+g++tdWvmheyrl
  AC233865.1_FGP003  97 RVLHHGGRSIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 134
                        ************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-644158IPR003441NAC domain
PROSITE profilePS5100560.3236157IPR003441NAC domain
PfamPF023657.9E-307134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG LKIELDIIPE VDLYKCEPWE LADKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVLH HGGRSIGMKK TLVYYRGRAP  120
QGVRTDWVMH EYRLDDKDAE DTLPIQDTYA LCRVFKKNAI CTEVDGLQAQ CSMALLEGAC  180
QQLLTSGSQE YQTSSPDVPV ASTSGGADDD AEKDESWMQF ISDDAWCSST ADGAEESTSR  240
VALAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-52115915170NAC domain-containing protein 19
3swm_B2e-52115915170NAC domain-containing protein 19
3swm_C2e-52115915170NAC domain-containing protein 19
3swm_D2e-52115915170NAC domain-containing protein 19
3swp_A2e-52115915170NAC domain-containing protein 19
3swp_B2e-52115915170NAC domain-containing protein 19
3swp_C2e-52115915170NAC domain-containing protein 19
3swp_D2e-52115915170NAC domain-containing protein 19
3ulx_A2e-52215711168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC233865.1_FG003
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC233865.1_FGP003
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280590.0KJ728059.1 Zea mays clone pUT6205 NAC transcription factor (NAC121) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008653037.10.0NAC domain-containing protein 86
SwissprotQ9FFI55e-82NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A1D6IAU60.0A0A1D6IAU6_MAIZE; NAC domain containing protein 57
TrEMBLA0A3L6E6B90.0A0A3L6E6B9_MAIZE; NAC domain-containing protein 86
STRINGAC233865.1_FGP0030.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-119NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]