PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AC194965.4_FGP004 | ||||||||
Common Name | GATA12, LOC103630069 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 143aa MW: 15575 Da PI: 10.6054 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.7 | 3.7e-19 | 29 | 63 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt Tp+WR gp g+++LCnaCG++yrkk++ AC194965.4_FGP004 29 CVECRTTATPMWRGGPTGPRSLCNACGIRYRKKRR 63 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 2.1E-14 | 23 | 82 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.71E-13 | 26 | 64 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 8.8E-15 | 28 | 64 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 5.2E-17 | 29 | 63 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 29 | 54 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.176 | 29 | 59 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 2.01E-11 | 29 | 64 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MMMDSAEHQK VMGIAPAAAP AAEAGRPCCV ECRTTATPMW RGGPTGPRSL CNACGIRYRK 60 KRRQELGLDS AKKPQQNQRP PPPQQQQQQE DHCPATSAVA VRDNTKSSRL QVVKKRRVLM 120 GVEEAAVLLM ALSSSSRSTL LHG |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | AC194965.4_FG004 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AC194965.4_FGP004 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728012 | 0.0 | KJ728012.1 Zea mays clone pUT6147 C2C2-GATA transcription factor (GATA12) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008649382.1 | 1e-101 | GATA transcription factor 23 | ||||
TrEMBL | K7UI23 | 1e-100 | K7UI23_MAIZE; C2C2-GATA transcription factor (Fragment) | ||||
STRING | AC194965.4_FGP004 | 1e-100 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 1e-20 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AC194965.4_FGP004 |
Entrez Gene | 103630069 |