PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015901925.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 114aa MW: 12340.1 Da PI: 5.7104 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 80.5 | 5.2e-25 | 6 | 69 | 4 | 67 |
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldesl 67 + ++eq+Cy+ CnfCn +lavsvP +sl+ +vtvrCGhCt+l svn+a a q ++ ++ +++ XP_015901925.1 6 DVAPEQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCTNLWSVNMAAAFQSMSLQDVQAQNY 69 5689********************************************9999888877544433 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.3E-27 | 8 | 108 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MSSCIDVAPE QLCYIPCNFC NIVLAVSVPC SSLLDIVTVR CGHCTNLWSV NMAAAFQSMS 60 LQDVQAQNYG YTAPTDYRID SGSSSRGSNK IAVRAPTANV TEERVVNRPV QCLC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015901925.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT090216 | 3e-68 | BT090216.1 Soybean clone JCVI-FLGm-3N14 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024923482.1 | 1e-74 | axial regulator YABBY 5-like, partial | ||||
Refseq | XP_024924682.1 | 4e-74 | axial regulator YABBY 5-like | ||||
Swissprot | Q8GW46 | 4e-41 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | W9RQQ7 | 3e-56 | W9RQQ7_9ROSA; Uncharacterized protein | ||||
STRING | XP_010105229.1 | 5e-57 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1124 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 2e-43 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|