PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015900818.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 200aa MW: 21090.3 Da PI: 6.6799 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.6 | 3.7e-58 | 24 | 119 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+++re+ege XP_015900818.1 24 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFREMEGE 118 89********************************************************************************************9 PP NF-YB 97 k 97 k XP_015900818.1 119 K 119 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.7E-54 | 17 | 121 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.16E-40 | 26 | 121 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.7E-28 | 29 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.5E-21 | 57 | 75 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.5E-21 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 6.5E-21 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MADSDNESGG GQNAGTNNSE LSPREQDRFL PIANVSRIMK KALPANAKIS KDAKETVQEC 60 VSEFISFVTG EASDKCQREK RKTINGDDLL WAMTTLGFEE YVEPLKVYLQ RFREMEGEKT 120 APLGVAREKD GGSGSVGNGG GGVGYGDGGG GGGGGVYGSG MGMVMMGQHH QHQHQGQVYG 180 SGGFHQMSKS GPGSNSARPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 7e-49 | 19 | 114 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015900818.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT031158 | 6e-68 | KT031158.1 Glycine max clone HN_CCL_197 CCAAT transcription factor (Glyma15g12570.1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015900818.1 | 1e-146 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 2e-71 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | G7K4Q5 | 2e-88 | G7K4Q5_MEDTR; Nuclear transcription factor Y protein | ||||
STRING | XP_004491514.1 | 4e-89 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 1e-73 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|