PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015900408.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 223aa MW: 25076.3 Da PI: 7.6339 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.6 | 2.2e-25 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri ++ rqv fskRr+g++KKA+ELSvLCd++ a+++fs++gk ye+s+ XP_015900408.1 9 KRIGDTQSRQVAFSKRRKGLFKKAHELSVLCDVDLALVVFSTSGKTYEFST 59 7999*********************************************96 PP | |||||||
2 | K-box | 32 | 5e-12 | 86 | 164 | 18 | 96 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 ++e a ++ ++n q+ +R + +Le+L+ ++ qLeq L+ sl+++ K +l+++++ l kkek++ een++ ++ XP_015900408.1 86 KEECADPRNGNSNVQSVKRAFDSLNLEQLNSIDIVQLEQLLNLSLRQVQYSKAQLMMKSMAVLHKKEKRVVEENQMVQN 164 5777777889999**999*********************************************************9886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.245 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.6E-31 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.82E-33 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 8.89E-27 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 7.393 | 82 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.2E-8 | 86 | 164 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MRRGKVEVKR IGDTQSRQVA FSKRRKGLFK KAHELSVLCD VDLALVVFST SGKTYEFSTG 60 NSISKILERH GSKSNSQKIA CGNDPKEECA DPRNGNSNVQ SVKRAFDSLN LEQLNSIDIV 120 QLEQLLNLSL RQVQYSKAQL MMKSMAVLHK KEKRVVEENQ MVQNENHIGV HMGNKELNIM 180 AVDSFQTYED DDDEGFHHAP IQMLGLENED GGVSYYRGGS LSL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3kov_B | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3kov_I | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3kov_J | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3p57_A | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3p57_B | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3p57_C | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3p57_D | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3p57_I | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
3p57_J | 2e-16 | 3 | 76 | 2 | 81 | Myocyte-specific enhancer factor 2A |
5f28_A | 2e-16 | 1 | 76 | 1 | 82 | MEF2C |
5f28_B | 2e-16 | 1 | 76 | 1 | 82 | MEF2C |
5f28_C | 2e-16 | 1 | 76 | 1 | 82 | MEF2C |
5f28_D | 2e-16 | 1 | 76 | 1 | 82 | MEF2C |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015900408.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015900408.1 | 1e-165 | MADS-box transcription factor 14-like isoform X1 |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF23130 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 6e-32 | MIKC_MADS family protein |