PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015899594.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 173aa MW: 18916.1 Da PI: 6.2725 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.6 | 3.7e-58 | 24 | 121 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplk+yl +yre+eg XP_015899594.1 24 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKIYLGRYREMEG 118 69********************************************************************************************* PP NF-YB 96 ekk 98 ++k XP_015899594.1 119 DTK 121 975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.3E-56 | 19 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.33E-41 | 27 | 129 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.4E-28 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.3E-21 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 9.3E-21 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 9.3E-21 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MAEAPVSPGG GSHESGDQSP RSNVREQDRY LPIANISRIM KKALPANGKI AKDAKETVQE 60 CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIEPLKIYL GRYREMEGDT 120 KGSSKGGEAS AKKDVQPSPN AQIAHQASFS QGVSYTNSQS QAQHMMVPMQ GTE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-48 | 23 | 115 | 1 | 93 | NF-YB |
4awl_B | 1e-48 | 23 | 115 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-48 | 23 | 115 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015899594.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024922348.1 | 1e-128 | nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Swissprot | Q8VYK4 | 2e-89 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2P5FUZ0 | 1e-120 | A0A2P5FUZ0_TREOI; Nuclear transcription factor Y subunit B | ||||
STRING | XP_006480596.1 | 1e-115 | (Citrus sinensis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 9e-92 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|