PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015895208.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 81aa MW: 9069.65 Da PI: 7.2695 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 63.2 | 1.1e-19 | 10 | 57 | 1 | 48 |
YABBY 1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsv 48 +d+++ se++Cyv+CnfCnt+lav +P + l+ +vtv+CGhC++l + XP_015895208.1 10 MDLVQPSEHLCYVRCNFCNTVLAVGLPCKRLLDTVTVKCGHCSNLSFL 57 578999*************************************98544 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 3.2E-20 | 15 | 64 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MNIDDKVTSM DLVQPSEHLC YVRCNFCNTV LAVGLPCKRL LDTVTVKCGH CSNLSFLSTR 60 PPVQGQCLDH PLSLQVIIIY Y |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015895208.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015895208.1 | 7e-54 | protein DROOPING LEAF | ||||
Swissprot | Q76EJ0 | 5e-29 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
TrEMBL | A0A067KYR0 | 3e-43 | A0A067KYR0_JATCU; Uncharacterized protein | ||||
STRING | XP_002512055.1 | 3e-41 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10259 | 30 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 1e-26 | YABBY family protein |