PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015891257.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 192aa MW: 22610.1 Da PI: 9.012 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.1 | 1.1e-50 | 10 | 138 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrF P+deelv++yL kk++++++ ++ e+d++++ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat++gyWkatgkd++vl+ XP_015891257.1 10 LPPGFRFYPSDEELVCHYLYKKITNEEVLK-GTLVEIDLHTCEPWQLPEVAKLNASEWYFFSFRDRKYATGYRTNRATTTGYWKATGKDRTVLDP 103 79************************9655.78***************87788899**************************************9 PP NAM 96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129 ++e +g++ktLvfy++rap+g kt W+mhe+rle XP_015891257.1 104 vTREIIGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138 88899***************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.68E-61 | 8 | 156 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.46 | 10 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.7E-28 | 11 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KITNEEVLKG TLVEIDLHTC EPWQLPEVAK 60 LNASEWYFFS FRDRKYATGY RTNRATTTGY WKATGKDRTV LDPVTREIIG MRKTLVFYRN 120 RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFHKSKAD DTNKLMEVEL LVFYLYEGFV 180 LAEKVKRREG SM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 6e-47 | 9 | 159 | 16 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-47 | 9 | 159 | 16 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-47 | 9 | 159 | 16 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-47 | 9 | 159 | 16 | 168 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-47 | 9 | 159 | 19 | 171 | NAC domain-containing protein 19 |
3swm_B | 6e-47 | 9 | 159 | 19 | 171 | NAC domain-containing protein 19 |
3swm_C | 6e-47 | 9 | 159 | 19 | 171 | NAC domain-containing protein 19 |
3swm_D | 6e-47 | 9 | 159 | 19 | 171 | NAC domain-containing protein 19 |
3swp_A | 6e-47 | 9 | 159 | 19 | 171 | NAC domain-containing protein 19 |
3swp_B | 6e-47 | 9 | 159 | 19 | 171 | NAC domain-containing protein 19 |
3swp_C | 6e-47 | 9 | 159 | 19 | 171 | NAC domain-containing protein 19 |
3swp_D | 6e-47 | 9 | 159 | 19 | 171 | NAC domain-containing protein 19 |
4dul_A | 6e-47 | 9 | 159 | 16 | 168 | NAC domain-containing protein 19 |
4dul_B | 6e-47 | 9 | 159 | 16 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015891257.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015891257.1 | 1e-142 | NAC domain-containing protein 21/22-like | ||||
Swissprot | Q84TE6 | 5e-63 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | R4NHJ5 | 1e-116 | R4NHJ5_JATCU; NAC transcription factor 009 | ||||
STRING | cassava4.1_030482m | 1e-117 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4381 | 33 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28530.1 | 1e-94 | NAC domain containing protein 74 |