PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890653.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HB-other
Protein Properties Length: 1753aa    MW: 197243 Da    PI: 4.9466
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890653.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.9e-183489257
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     kR+  t+ qle+Le++++ + yps+++r++L++klgL++rq ++WF+ rR k+kk
  XP_015890653.1 34 PKRQMKTPFQLETLEKAYALETYPSESMRADLSEKLGLSDRQLQMWFCHRRLKDKK 89
                    69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-181490IPR009057Homeodomain-like
SuperFamilySSF466893.17E-162390IPR009057Homeodomain-like
PROSITE profilePS5007116.6653090IPR001356Homeobox domain
SMARTSM003891.0E-173294IPR001356Homeobox domain
PfamPF000463.9E-163489IPR001356Homeobox domain
CDDcd000861.23E-133590No hitNo description
SMARTSM005713.2E-22533592IPR018501DDT domain
PROSITE profilePS5082716.469533592IPR018501DDT domain
PfamPF027912.9E-16534589IPR018501DDT domain
PfamPF050665.6E-15715783IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156122.8E-8924964IPR028942WHIM1 domain
PfamPF156135.7E-1311161188IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1753 aa     Download sequence    Send to blast
MEGGSEGEDH NIKNSENNNE SSKINNSNEG QSKPKRQMKT PFQLETLEKA YALETYPSES  60
MRADLSEKLG LSDRQLQMWF CHRRLKDKKE GGPPKKARKT VAALPESPID ELRAGHEPGS  120
DYGSGSGSGS SPFGHTELRN AVSRSVGDDM PMGRRYYESR QTIMELRAIA CVEAQLGEPL  180
RDDGPVLGIE FDPLPPDAFG APLAVAEQQK RSGHHPFEGK SYERHDAKSN KATTRVLYEY  240
PFLQDQSTSA VDVLPGRTSS FAVVNEQLSR AHVVQGQVSR VRLLSQQDKQ GVAFPSPPRD  300
DDRVPQRDSF TNSRMISDHP IIVSDNPYGS DGQIIPSDTV LRMERKRKSE EARLAKEVEA  360
HEIRLRKELE KQDNLRRKNE ERLRKEMEKQ DRERRKEEER LMREKQREEE RSRREQRREM  420
ERREKFLQKE SLRAEKRRQK EELRKEREAV RRKAAIEKAT ARRIARESME LIEDEQLELM  480
EIAAASKGLS SIISLDHDTL QNLESFRDLL GQFPPMSVQL KRPLAIQPWI NSEENIGNLL  540
MIWRFLITFA DVLELWPFTL DEFIQGFHDY DSRLLGEIHV ALLKLIIKDI EDVARTPSSG  600
LGTNQNGAAN PGGGHPQIVE GAYAWGFDIR NWQRHLNPLT WPEIFRQLAL SAGFGPHLKK  660
RSVSWPCLPD NHEGKGCEDV ISTLRSGSAA ENAFAIMQEK GLLLPRRSRH RLTPGTVKFA  720
AFHVLSLEGS KGLTVLELAD KIQKSGLRDL TTSKTPEASI SVALTRDAKL FERIAPSTYR  780
VRAAYRKDPA DAEAILSAAR KKVQIFENGF LAAEDADDVE RDEDSECDDV DEDPEVDELA  840
TPSTANRDSD QYNEVNTCLE SGKENLCNDP LNLQNEFDKD SSSVPLIASK DVDCSSATTE  900
QYVVGEDRNA SNPEEENMEI DESKSGESWT QGLTEGEYSD LSVEERLNAL VALIGIANEG  960
NSIRLVLEDR LEAANALKKQ MWGEAQLDKS RLKEENISKL DFPSSVGTKA EMHLASSVVE  1020
GSQSPLPDLD NRNIEASNRN SEASPSIAEN QKLVNVSHII PNDLNSVPAE KTSVAPDFSM  1080
GPDNFLTQQQ AFANKRSRSQ LKSYIAHRAE EMYVYRSLPL GQDRRRNRYW QFVASASSND  1140
PGSGRIFVEL HDGNWRLIDT EEAFETLLGS LDSRGIRESH LRLMLQKIEA SFKENVRRNV  1200
QCLSTVGGNG TVVKNEVDEM NSSPDCHAAF DSPSSTLCGL NPDSIETSSS FRIELGKSET  1260
EKKAALRRYQ DFQKWMFKEC LNASTLYAMK CGKKRCAQLL EICDGCLTTY YFEDSHCLSC  1320
HQTFGTMGND FKFPQHVIQC KEKRKLELQD IHILDTALPL GNRLLKVLFA LIEVSVPLEA  1380
LQSSWMEDFR KNWGVKLNVS SSVEELLQIF TLFESVMKRD FLLSNFASTG ELLGSCSQPG  1440
AAAHDYSDPG SVTVLPWLPH TIAAVALRLF ELDASIIYVP HAKPEPVEAK EVKEYIKLPT  1500
RFAPSRNDKE IELAELSHRE HMKEENFAHL KSARNNYRRG KGGRDQRRGK KLQRRVNNSK  1560
SSAARKNART NENTTQGLRQ LGRRPLGQGG ARGRRTIRKR RVENRAVEET LLGHIADTRS  1620
SPESGGESPR NLDEEWDDEK INNINVKGDD VNSVEAVESD DNNAQAEEYE QGNWELGYDG  1680
VSGGWNGDLM EVSDEDVDAS EDDDDDDDNG IEEVGDGDSE EDVDVSEESD GIPNRIENDE  1740
GSESAVSEDY SDD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18289RRLKDKKE
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015890653.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890653.10.0homeobox-DDT domain protein RLT1 isoform X1
RefseqXP_024922307.10.0homeobox-DDT domain protein RLT1 isoform X2
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A2P5CI270.0A0A2P5CI27_TREOI; Octamer-binding transcription factor
STRINGXP_010111176.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1