PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015888995.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 193aa MW: 21252.2 Da PI: 7.5352 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 209.7 | 1e-64 | 12 | 170 | 2 | 159 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshld..eslkee..lleelkvee.enlksnvekees 91 ++ s s+q+Cyv+CnfC+t+lavsvP tslfk+vtvrCGhC++llsvn++ aa ++l+ ++l ++ lle+ ++++ +n+ ++++ XP_015888995.1 12 HHLSPSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCSNLLSVNMRALLLPAAAANQLHfgHNLLNPqhLLEDIRSTTpSNIL---INNQP 103 68899*****************************************99998887666666654114444432344444332202222...22223 PP YABBY 92 astsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159 ++ +++ + ee+pr+p v+rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaakn XP_015888995.1 104 NQINEPLIP-IRGGAEEIPRPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKN 170 333333333.467899***************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.8E-62 | 16 | 170 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 6.28E-6 | 125 | 168 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MQPSSAAFSP DHHLSPSDQL CYVHCNFCDT VLAVSVPCTS LFKTVTVRCG HCSNLLSVNM 60 RALLLPAAAA NQLHFGHNLL NPQHLLEDIR STTPSNILIN NQPNQINEPL IPIRGGAEEI 120 PRPPVVNRPP EKRQRVPSAY NRFIKDEIQR IKAGNPDISH REAFSAAAKN EGEPDMLLKD 180 GYFTPANVGV SPY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015888995.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC139089 | 2e-52 | KC139089.1 Vitis pseudoreticulata transcription factor YABBY1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024931971.1 | 1e-120 | axial regulator YABBY 1-like isoform X1 | ||||
Swissprot | O22152 | 5e-70 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | A0A2C9VVJ5 | 9e-98 | A0A2C9VVJ5_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_016105m | 2e-98 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2040 | 34 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 7e-67 | YABBY family protein |