PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015885856.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 149aa MW: 16783.4 Da PI: 10.103 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 29.2 | 1.6e-09 | 85 | 131 | 7 | 53 |
--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS Homeobox 7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 ++k +++Le+++++++ p+ +++ + + ++L+ ++V WF +Ra XP_015885856.1 85 LKKVHVQTLESVYRRTKRPTNAMISSIVHVTNLPRKRVIKWFEDKRA 131 5677899***************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 9.475 | 76 | 136 | IPR001356 | Homeobox domain |
SMART | SM00389 | 2.1E-4 | 82 | 140 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.55E-7 | 82 | 131 | No hit | No description |
SuperFamily | SSF46689 | 3.51E-9 | 82 | 140 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.9E-9 | 84 | 143 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 4.1E-7 | 85 | 131 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0002229 | Biological Process | defense response to oomycetes | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009682 | Biological Process | induced systemic resistance | ||||
GO:0009787 | Biological Process | regulation of abscisic acid-activated signaling pathway | ||||
GO:0010118 | Biological Process | stomatal movement | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:2000022 | Biological Process | regulation of jasmonic acid mediated signaling pathway | ||||
GO:2000071 | Biological Process | regulation of defense response by callose deposition | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MQIKTLAAEL CLDRALVLEL LREPPPSLLM MSAALPDEPP ATVSVTETKP VETVAKITAD 60 TAEPDTSTKV PVHVLQQKFS AQKRLKKVHV QTLESVYRRT KRPTNAMISS IVHVTNLPRK 120 RVIKWFEDKR AEDEVPENRT PYQRSSVSS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015885856.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015885855.1 | 1e-104 | protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 | ||||
Refseq | XP_015885856.1 | 1e-104 | protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 | ||||
Swissprot | Q8H0V5 | 5e-55 | OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 | ||||
TrEMBL | W9SFM3 | 3e-68 | W9SFM3_9ROSA; Uncharacterized protein | ||||
STRING | XP_010110355.1 | 5e-69 | (Morus notabilis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11270.1 | 7e-44 | overexpressor of cationic peroxidase 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|