PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015885855.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HB-other
Protein Properties Length: 149aa    MW: 16783.4 Da    PI: 10.103
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015885855.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-0985131753
                     --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     ++k  +++Le+++++++ p+ +++  + + ++L+ ++V  WF  +Ra
  XP_015885855.1  85 LKKVHVQTLESVYRRTKRPTNAMISSIVHVTNLPRKRVIKWFEDKRA 131
                     5677899***************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.47576136IPR001356Homeobox domain
SMARTSM003892.1E-482140IPR001356Homeobox domain
CDDcd000861.55E-782131No hitNo description
SuperFamilySSF466893.51E-982140IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-984143IPR009057Homeodomain-like
PfamPF000464.1E-785131IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MQIKTLAAEL CLDRALVLEL LREPPPSLLM MSAALPDEPP ATVSVTETKP VETVAKITAD  60
TAEPDTSTKV PVHVLQQKFS AQKRLKKVHV QTLESVYRRT KRPTNAMISS IVHVTNLPRK  120
RVIKWFEDKR AEDEVPENRT PYQRSSVSS
Functional Description ? help Back to Top
Source Description
UniProtMay modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015885855.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015885855.11e-104protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
RefseqXP_015885856.11e-104protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
SwissprotQ8H0V55e-55OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLW9SFM33e-68W9SFM3_9ROSA; Uncharacterized protein
STRINGXP_010110355.15e-69(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101813138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.17e-44overexpressor of cationic peroxidase 3
Publications ? help Back to Top
  1. García-Andrade J,Ramírez V,López A,Vera P
    Mediated plastid RNA editing in plant immunity.
    PLoS Pathog., 2013. 9(10): p. e1003713
    [PMID:24204264]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gamir J,Pastor V,Kaever A,Cerezo M,Flors V
    Targeting novel chemical and constitutive primed metabolites against Plectosphaerella cucumerina.
    Plant J., 2014. 78(2): p. 227-40
    [PMID:24506441]