PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015882140.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 128aa MW: 14978.4 Da PI: 10.1039 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.8 | 2.9e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELS+LCdae+a++ifs+ gk+y y+s XP_015882140.1 9 KRIENPTTRQVTFSKRRNGLLKKAFELSILCDAEIALLIFSPAGKVYQYAS 59 79***********************************************86 PP | |||||||
2 | K-box | 31.8 | 5.8e-12 | 84 | 126 | 12 | 54 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqL 54 ++ e +++e++ k+ +enL+r +Rhl GedL L +keL+qL XP_015882140.1 84 RTVEFWRNEIEETKRATENLERRLRHLSGEDLLMLGMKELKQL 126 56899*************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.973 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.89E-33 | 2 | 80 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.21E-40 | 2 | 70 | No hit | No description |
PRINTS | PR00404 | 1.4E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.8E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.6E-8 | 86 | 126 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 7.576 | 86 | 128 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MGRGKVELKR IENPTTRQVT FSKRRNGLLK KAFELSILCD AEIALLIFSP AGKVYQYASH 60 DMDRIIGRYR REVGLPESDS LRCRTVEFWR NEIEETKRAT ENLERRLRHL SGEDLLMLGM 120 KELKQLIV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 6e-25 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015882140.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015882140.1 | 1e-89 | MADS-box transcription factor 6-like | ||||
Swissprot | Q8LLR1 | 7e-41 | MADS3_VITVI; Agamous-like MADS-box protein MADS3 | ||||
TrEMBL | W9QX82 | 3e-68 | W9QX82_9ROSA; Agamous-like MADS-box protein AGL16 | ||||
STRING | XP_010086970.1 | 4e-69 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 5e-39 | AGAMOUS-like 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|