PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881268.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HB-other
Protein Properties Length: 1756aa    MW: 197266 Da    PI: 5.3723
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881268.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-181874157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    + kR   t++qle+Le+ ++ ++yps++ r+eL++klgL++rq ++WF+ rR k++k
  XP_015881268.1 18 KTKRKMKTASQLEILEKTYAVESYPSESLRAELSSKLGLSDRQLQMWFCHRRLKDRK 74
                    6799***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-17474IPR009057Homeodomain-like
SuperFamilySSF466892.57E-151374IPR009057Homeodomain-like
PROSITE profilePS5007116.7461575IPR001356Homeobox domain
SMARTSM003891.4E-161779IPR001356Homeobox domain
CDDcd000862.96E-131874No hitNo description
PfamPF000465.2E-161874IPR001356Homeobox domain
PROSITE profilePS5082717.399524583IPR018501DDT domain
SMARTSM005713.1E-23524583IPR018501DDT domain
PfamPF027911.8E-17525580IPR018501DDT domain
PfamPF050663.1E-15706774IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.6E-8927968IPR028942WHIM1 domain
PfamPF156131.8E-1311101182IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1756 aa     Download sequence    Send to blast
MEAGSEGEKK KPPEGENKTK RKMKTASQLE ILEKTYAVES YPSESLRAEL SSKLGLSDRQ  60
LQMWFCHRRL KDRKVAPVKR SRKESPVVVG IEGGSGGKMV VGDVGNEHIS GLGLGSSSFG  120
HSVDSRRVLA RPSLAVPRIG GDIPFIKRYY EPQQSIVELR AIAFVEAQLG EPLREDGPIL  180
GMEFDPLPPD AFGTPIGTSI VGQQKQSARS FDAKIYDQSD AKSVKVAARA LHEYQFIPEQ  240
PTVRLDSYER FTPSYQYGSP LDGPNAKTSS IPTGHLFIHG NEQLPSGYGF QGEYDKVQRK  300
NTKINMDAHP ISQLENPFML SDRRVTHDED VIRVERKRKS EEAKIAREVE AHEKRIRKEL  360
EKQDILRRKR EEQIRKEMER HDRERRKEEE RLLREKQREE ERYQREQRRE LERREKFLLK  420
ESIRAEKMRQ KEELRREKEA ARLKAANERA IARRIAKESM ELIEDERLEL MELAASSKGL  480
PSIASLDYES LQNLDSYRDM RNSFPPKSVH LKRPFAIQPW AGSEENIGNL LMVWRFLITF  540
ADVLGLWPFT LDEFIQAFHD YDSRLLGEIH VSLLRSIIKD IEDVARTPSM GLGANQNGTA  600
NPGGGHPEIV EGAYAWGFDI RSWQHNLNPL TWPEILRQFA LSAGLGPQLK KRNVEPVCLR  660
DDNEGNDGKD IISNLRNGAA VENAFAIMQE RGFSNPRRSR HRLTPGTVKF AAFHVLSLEG  720
NKGLTILEVA DRIQKSGLRD LTTSKTPEAS IAAALSRDSK LFERTAPSTY CVRASYRKDP  780
ADAESILASA RERIRIFKSG VLDGEDAEDA ERDDDSESDA AEDPEVDDLG TEINPIKEAG  840
DFQELNKFNA KTLLGNGKES SHHILETPEK DLRNIDEGLS AIDSEGHVKM KDTSLSYGQT  900
GQTVDVAGMD ASTIDQEDAD IDGSHLGEPW VQGLMEGEYS DLSVEERLNA LAALIGVAIE  960
GNSIRLILEV RLEAANALKK QMWAEVQLDK RRMKEEYIMR MHYSSLMGNK FEPNVTNSSA  1020
GGGPSPFLTV GDKNNETTVD LSVQEEQIND LHTENNYISS FPSERNLQMQ EVPTGPDNHL  1080
FPQSGCAADR SRSQLKSYIG YKAEEMYVYR SLPLGQDRRR NRYWQFITSA SPNDPGCGRI  1140
FVELQDGRWR LIDSEEGFDA LLASLDVRGI RESQLHTMLQ KIGVSFKKIV KKSMLHDNVG  1200
RECEHNVKKE TVEMTLHPDF SIGNDSPSST VCLADSDMLE TSTSFVIELG RNEIEKNSAL  1260
KRYQDLEKWI WKECFSSSMI CAIKDGKKRC KQLLNICDYC SSIYSSEDNH CPSCHRIYAT  1320
SESGFNFSEH LAQCKRKLKL EEHCALHGSS FVPQRIRMLK MLLSLVEVSV PPEALQSLWT  1380
ESHRKSWGIE LTSSSSAKDL LQVLTVLEGA VKRDYLSSNF ETTNELLDSS NPVRFAATNS  1440
TLSKSVTILP WIPLTTAAVA LRLMEFDAAI SYTLQQKVES RKNKESGDLN KHPSTHAVLK  1500
SSVSAETLST TCQANNLQEE NWADPGIGLD SFGRGRGSRG GAYGRTRSGR SQRRAIGSRA  1560
ESVKHNAATN NERLGQVLEW EGRSRGHGHR RGRRSIRSRQ KPSKKMVEIG GERSSPKEGT  1620
SDKSPRSLVN AWNRVETANF QLEGAELASS SGRSEYDDEN GQASEDEYDD MVVDDYATGL  1680
NGKSDDLLDG SDYNVNGDED EADDDVEDEE EDGEGDFDVD RYINGDSDGE ENRAGDEEQN  1740
MKLNEGTGST SSEYSD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015881268.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2662239e-72KF266223.1 Ziziphus jujuba microsatellite SSR723 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881268.10.0homeobox-DDT domain protein RLT2 isoform X2
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A2I4F9F20.0A0A2I4F9F2_JUGRE; homeobox-DDT domain protein RLT2-like isoform X1
STRINGXP_010093958.10.0(Morus notabilis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator