PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881267.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HB-other
Protein Properties Length: 1779aa    MW: 199692 Da    PI: 5.4316
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881267.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-181874157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    + kR   t++qle+Le+ ++ ++yps++ r+eL++klgL++rq ++WF+ rR k++k
  XP_015881267.1 18 KTKRKMKTASQLEILEKTYAVESYPSESLRAELSSKLGLSDRQLQMWFCHRRLKDRK 74
                    6799***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-17474IPR009057Homeodomain-like
SuperFamilySSF466892.61E-151374IPR009057Homeodomain-like
PROSITE profilePS5007116.7461575IPR001356Homeobox domain
SMARTSM003891.4E-161779IPR001356Homeobox domain
CDDcd000862.87E-131874No hitNo description
PfamPF000465.3E-161874IPR001356Homeobox domain
SMARTSM005713.1E-23547606IPR018501DDT domain
PROSITE profilePS5082717.399547606IPR018501DDT domain
PfamPF027911.9E-17548603IPR018501DDT domain
PfamPF050663.1E-15729797IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.6E-8950991IPR028942WHIM1 domain
PfamPF156131.8E-1311331205IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1779 aa     Download sequence    Send to blast
MEAGSEGEKK KPPEGENKTK RKMKTASQLE ILEKTYAVES YPSESLRAEL SSKLGLSDRQ  60
LQMWFCHRRL KDRKVAPVKR SRKESPVVVG IEGGSGGKMV VGDVGNEHIS GLGLGSSSFG  120
HSVDSRRVLA RPSLAVPRIG GDIPFIKRYY EPQQSIVELR AIAFVEAQLG EPLREDGPIL  180
GMEFDPLPPD AFGTPIGTSI VGQQKQSARS FDAKIYDQSD AKSVKVAARA LHEYQFIPEQ  240
PTVRLDSYER FTPSYQYGSP LDGPNAKTSS IPTGHLFIHG NEQLPSGYGF QGQITGLNLL  300
SQQGRPNHLL PSISGEYDKV QRKNTKINMD AHPISQLENP FMLSDRRVTH DEDVIRVERK  360
RKSEEAKIAR EVEAHEKRIR KELEKQDILR RKREEQIRKE MERHDRERRK EEERLLREKQ  420
REEERYQREQ RRELERREKF LLKESIRAEK MRQKEELRRE KEAARLKAAN ERAIARRIAK  480
ESMELIEDER LELMELAASS KGLPSIASLD YESLQNLDSY RDMRNSFPPK SVHLKRPFAI  540
QPWAGSEENI GNLLMVWRFL ITFADVLGLW PFTLDEFIQA FHDYDSRLLG EIHVSLLRSI  600
IKDIEDVART PSMGLGANQN GTANPGGGHP EIVEGAYAWG FDIRSWQHNL NPLTWPEILR  660
QFALSAGLGP QLKKRNVEPV CLRDDNEGND GKDIISNLRN GAAVENAFAI MQERGFSNPR  720
RSRHRLTPGT VKFAAFHVLS LEGNKGLTIL EVADRIQKSG LRDLTTSKTP EASIAAALSR  780
DSKLFERTAP STYCVRASYR KDPADAESIL ASARERIRIF KSGVLDGEDA EDAERDDDSE  840
SDAAEDPEVD DLGTEINPIK EAGDFQELNK FNAKTLLGNG KESSHHILET PEKDLRNIDE  900
GLSAIDSEGH VKMKDTSLSY GQTGQTVDVA GMDASTIDQE DADIDGSHLG EPWVQGLMEG  960
EYSDLSVEER LNALAALIGV AIEGNSIRLI LEVRLEAANA LKKQMWAEVQ LDKRRMKEEY  1020
IMRMHYSSLM GNKFEPNVTN SSAGGGPSPF LTVGDKNNET TVDLSVQEEQ INDLHTENNY  1080
ISSFPSERNL QMQEVPTGPD NHLFPQSGCA ADRSRSQLKS YIGYKAEEMY VYRSLPLGQD  1140
RRRNRYWQFI TSASPNDPGC GRIFVELQDG RWRLIDSEEG FDALLASLDV RGIRESQLHT  1200
MLQKIGVSFK KIVKKSMLHD NVGRECEHNV KKETVEMTLH PDFSIGNDSP SSTVCLADSD  1260
MLETSTSFVI ELGRNEIEKN SALKRYQDLE KWIWKECFSS SMICAIKDGK KRCKQLLNIC  1320
DYCSSIYSSE DNHCPSCHRI YATSESGFNF SEHLAQCKRK LKLEEHCALH GSSFVPQRIR  1380
MLKMLLSLVE VSVPPEALQS LWTESHRKSW GIELTSSSSA KDLLQVLTVL EGAVKRDYLS  1440
SNFETTNELL DSSNPVRFAA TNSTLSKSVT ILPWIPLTTA AVALRLMEFD AAISYTLQQK  1500
VESRKNKESG DLNKHPSTHA VLKSSVSAET LSTTCQANNL QEENWADPGI GLDSFGRGRG  1560
SRGGAYGRTR SGRSQRRAIG SRAESVKHNA ATNNERLGQV LEWEGRSRGH GHRRGRRSIR  1620
SRQKPSKKMV EIGGERSSPK EGTSDKSPRS LVNAWNRVET ANFQLEGAEL ASSSGRSEYD  1680
DENGQASEDE YDDMVVDDYA TGLNGKSDDL LDGSDYNVNG DEDEADDDVE DEEEDGEGDF  1740
DVDRYINGDS DGEENRAGDE EQNMKLNEGT GSTSSEYSD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015881267.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2662239e-72KF266223.1 Ziziphus jujuba microsatellite SSR723 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881267.10.0homeobox-DDT domain protein RLT2 isoform X1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A2I4F9F20.0A0A2I4F9F2_JUGRE; homeobox-DDT domain protein RLT2-like isoform X1
STRINGXP_010093958.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator