PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015876427.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 27797.5 Da PI: 9.9949 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.3 | 1.5e-31 | 24 | 73 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ XP_015876427.1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 73 79***********************************************8 PP | |||||||
2 | K-box | 111.4 | 9.1e-37 | 91 | 188 | 3 | 100 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +s++ s++ea+a+ +qqe+akL+++i + q+++R +lGe+L+sLslk+L++Le +Le++++kiRskKnell+++ie++qk+e +l+++n+ Lr+k XP_015876427.1 91 SSNTGSVSEANAQFYQQEAAKLRSQIGSVQKQNREMLGECLSSLSLKDLKNLEGKLERGISKIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAK 185 3445559**************************************************************************************** PP K-box 98 lee 100 ++e XP_015876427.1 186 IAE 188 986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.4E-41 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.669 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.49E-33 | 17 | 89 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.80E-44 | 17 | 93 | No hit | No description |
PRINTS | PR00404 | 4.4E-33 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.1E-27 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-33 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-33 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.2E-27 | 100 | 186 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.946 | 102 | 192 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MAYQNKSMSV SPQRKLGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 IVFSSRGRLY EYANNSVKST IERYKKACSD SSNTGSVSEA NAQFYQQEAA KLRSQIGSVQ 120 KQNREMLGEC LSSLSLKDLK NLEGKLERGI SKIRSKKNEL LFAEIEYMQK REIDLHNNNQ 180 LLRAKIAENE RNQQNISMMA GGGGGGNYEI MQSQPFDSRN YFQVNALQPN NEYSRQDQMA 240 LQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 1e-20 | 16 | 84 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 16 | 84 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 16 | 84 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 16 | 84 | 1 | 69 | MEF2C |
6c9l_A | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015876427.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015876427.1 | 1e-178 | floral homeotic protein AGAMOUS isoform X3 | ||||
Refseq | XP_015876435.1 | 1e-178 | floral homeotic protein AGAMOUS isoform X4 | ||||
Swissprot | Q40872 | 1e-136 | AG_PANGI; Floral homeotic protein AGAMOUS | ||||
TrEMBL | G9JJR2 | 1e-147 | G9JJR2_9ROSI; MADS1 | ||||
STRING | XP_008225406.1 | 1e-147 | (Prunus mume) | ||||
STRING | EMJ13124 | 1e-147 | (Prunus persica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-126 | MIKC_MADS family protein |