PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015872841.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 164aa MW: 18266.2 Da PI: 5.6576 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 91.4 | 9.7e-29 | 109 | 164 | 2 | 57 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--S CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDe 57 C v++C+adls+++eyh+rh+vCe hsk+p+v+v+g+e+rfCqqCsrfh+l efDe XP_015872841.1 109 CLVDDCKADLSSCREYHKRHRVCERHSKTPTVMVKGEEKRFCQQCSRFHALGEFDE 164 *******************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 5.6E-29 | 102 | 164 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 23.282 | 106 | 164 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 9.81E-27 | 107 | 164 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.0E-22 | 109 | 164 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
NQGEQIEKVD GVMEWDLKEF AWESTHELDQ QKEESDLTAM VEFSTSKKQT TTTTVNGSSG 60 DLKLTVVDSA EPVSFSKSNE ARTTSILASS PTSPGPSSKK VNGAQKVSCL VDDCKADLSS 120 CREYHKRHRV CERHSKTPTV MVKGEEKRFC QQCSRFHALG EFDE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 4e-20 | 107 | 163 | 4 | 60 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | SBP transcriptional regulator probably involved in the domestication of maize. Acts as a transcriptional repressor binding to a 5'-GTAC-3' motif. May repress the growth of lateral branches in length and numbers. {ECO:0000250|UniProtKB:Q49I55}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015872841.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015871790.1 | 1e-116 | squamosa promoter-binding-like protein 13A isoform X2 | ||||
Refseq | XP_015871791.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X3 | ||||
Refseq | XP_015871794.1 | 1e-116 | squamosa promoter-binding-like protein 13A isoform X2 | ||||
Refseq | XP_015871795.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X3 | ||||
Refseq | XP_015871799.1 | 1e-116 | squamosa promoter-binding-like protein 13A isoform X2 | ||||
Refseq | XP_015871800.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X3 | ||||
Refseq | XP_015872096.1 | 1e-118 | squamosa promoter-binding-like protein 13A, partial | ||||
Refseq | XP_015872841.1 | 1e-119 | teosinte glume architecture 1-like, partial | ||||
Refseq | XP_015872885.1 | 1e-118 | squamosa promoter-binding protein 2-like, partial | ||||
Refseq | XP_024925862.1 | 1e-116 | squamosa promoter-binding-like protein 13A isoform X4 | ||||
Refseq | XP_024925868.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X4 | ||||
Refseq | XP_024925870.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X4 | ||||
Refseq | XP_024925872.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X4 | ||||
Swissprot | Q49I57 | 2e-24 | TGA1B_MAIZE; Teosinte glume architecture 1 | ||||
TrEMBL | A0A2P5CJQ3 | 3e-55 | A0A2P5CJQ3_PARAD; SBP-box transcription factor | ||||
STRING | XP_010112387.1 | 5e-40 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10031 | 26 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 3e-26 | SBP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|