PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015866170.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 150aa MW: 16683.1 Da PI: 10.0609 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 75 | 5.9e-24 | 22 | 69 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 + en+sn+qvtfskRr+g++KKA ELS+LC+aeva i+fs++ k++ y XP_015866170.1 22 KLENNSNKQVTFSKRRAGLFKKAGELSILCGAEVAAIVFSPNSKVFCY 69 679****************************************99877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.2E-32 | 13 | 72 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 27.053 | 13 | 73 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.49E-29 | 14 | 92 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.04E-32 | 14 | 81 | No hit | No description |
PRINTS | PR00404 | 1.9E-22 | 15 | 35 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-23 | 23 | 69 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-22 | 35 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-22 | 50 | 71 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MIVRTNKTIK KTQGRQKIEI KKLENNSNKQ VTFSKRRAGL FKKAGELSIL CGAEVAAIVF 60 SPNSKVFCYG HPSPETVIQR YIHSTTSSNT SNSSEAAVAA MASAAATSAE RELVPMEEFN 120 REYREAMKEL EIEKKRAEEV KLAVEEKKSA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 3e-17 | 14 | 81 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_B | 3e-17 | 14 | 81 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_C | 3e-17 | 14 | 81 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_D | 3e-17 | 14 | 81 | 1 | 68 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015866170.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015866170.1 | 1e-105 | agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A498KGD9 | 9e-43 | A0A498KGD9_MALDO; Uncharacterized protein | ||||
STRING | XP_008232412.1 | 1e-43 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF128 | 33 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 4e-30 | AGAMOUS-like 62 |