PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00165.1.g00160.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 706aa    MW: 77526.4 Da    PI: 4.891
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00165.1.g00160.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.2e-534655931128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtdeelv++yLk+k++g ++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat+
  Zjn_sc00165.1.g00160.1.am.mk 465 LPPGFRFHPTDEELVNYYLKRKIHGLEIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATR 544
                                   79****************************.99**************85335566888*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWk+tgkd++vl+++g+ +g+kktLv+y+grap+g++t Wvmheyrl
  Zjn_sc00165.1.g00160.1.am.mk 545 AGYWKSTGKDRRVLHHGGRRIGMKKTLVYYRGRAPQGVRTGWVMHEYRL 593
                                   ***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF034782.0E-6315350IPR005174Domain unknown function DUF295
SuperFamilySSF1019413.92E-64458616IPR003441NAC domain
PROSITE profilePS5100560.323465616IPR003441NAC domain
PfamPF023654.8E-29466593IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MAQEQARLGW SSGLPEPEIL ESIGKGLASG HDAASFRSAC VSWRAALPFK SFAPLLLLPF  60
GPESESVTFY SVSEEEIDSK PLPDDVRGRE PCGASRGWLA LMDEAASVML LNPFTGARVE  120
LPPADEHAAA ASSGTRVSKV DGRWVLLPDD GYGNAEAVRV INLEEMRDVF IREIVLSAQP  180
YAGRECIAMA VLPNSTMVAF CRVGVDSAWT LLDTNLECSV ACIVHCQERI FAVDITGDIS  240
ICNFNTGAGA PPTATPLPSL SAPEGVCNRS YLESNGELHI VGVMVTTFHE TKTFTSNIVV  300
YKCDFLLDQT PVWSKVDDIG DMTLLVSKDF SESFGGASVS KYKRNSIYFS EALYGDPKIS  360
AIQRVLEERP GDHLIGGARG KVYSSGFVRV GNLEKSNRNP AGKGIDPDQR HVSAQREAEQ  420
ARCLSPASIS FLSATADVQL VRHQYVVRSP PPTLREGYMA ARAGLPPGFR FHPTDEELVN  480
YYLKRKIHGL EIELDIIPEV DLYKCEPWEL ADKSFLPSRD PEWYFFGPRD RKYPNGFRTN  540
RATRAGYWKS TGKDRRVLHH GGRRIGMKKT LVYYRGRAPQ GVRTGWVMHE YRLDDKDAED  600
TMPMQDTYAL CRVFKKNAIC TEVDDLQAAQ CNMALLEGAC QQLLPSGSQE YETPSPDVPV  660
GSTSGGADVE DADKDDSWMQ FISDDAWCSS SADGAEESAS CVALAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-4946561820170NAC domain-containing protein 19
3swm_B2e-4946561820170NAC domain-containing protein 19
3swm_C2e-4946561820170NAC domain-containing protein 19
3swm_D2e-4946561820170NAC domain-containing protein 19
3swp_A2e-4946561820170NAC domain-containing protein 19
3swp_B2e-4946561820170NAC domain-containing protein 19
3swp_C2e-4946561820170NAC domain-containing protein 19
3swp_D2e-4946561820170NAC domain-containing protein 19
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280590.0KJ728059.1 Zea mays clone pUT6205 NAC transcription factor (NAC121) mRNA, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-112NAC domain containing protein 57