PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00127.1.g00480.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 441aa    MW: 47408.2 Da    PI: 7.3401
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00127.1.g00480.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-17128175148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg W++eEde+l+  ++++G g+W+++++  g+ R++k+c++rw +yl
  Zjn_sc00127.1.g00480.1.am.mk 128 RGLWSPEEDEKLISHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 175
                                   788*******************************************97 PP

2Myb_DNA-binding55.61.2e-17181225147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg +++eE++l+++++ +lG++ W+ Ia++++ gRt++++k++w++y
  Zjn_sc00127.1.g00480.1.am.mk 181 RGTFSQEEEDLIIQLHSMLGNK-WSQIAAHLP-GRTDNEVKNFWNSY 225
                                   899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-26120178IPR009057Homeodomain-like
PROSITE profilePS5129419.36123175IPR017930Myb domain
SuperFamilySSF466893.71E-30126222IPR009057Homeodomain-like
SMARTSM007173.8E-14127177IPR001005SANT/Myb domain
PfamPF002498.8E-16128175IPR001005SANT/Myb domain
CDDcd001671.53E-12131175No hitNo description
PROSITE profilePS5129427.254176230IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-26179230IPR009057Homeodomain-like
SMARTSM007173.1E-17180228IPR001005SANT/Myb domain
PfamPF002491.2E-16181225IPR001005SANT/Myb domain
CDDcd001673.14E-12183226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MAPVPVFLSG PGPFLSFPLG HVINQAKEKR QETSSAAKRG ARTRAVACAT GKGKAGNENT  60
YLRSTSLLAS SSLHWHQSLL CSSSPSPSFP ACHHQNLGSS SRSAWTADTS DVDDGDTHSC  120
CHKKKLRRGL WSPEEDEKLI SHIAKYGHGC WSSVPKLAGL ERCGKSCRLR WINYLRPDLK  180
RGTFSQEEED LIIQLHSMLG NKWSQIAAHL PGRTDNEVKN FWNSYIKKRL RERGIDPATH  240
KPIADVSASD AATTGACHAV FCDAELIPTT AALLQAPLAE PMLDDVVKPP SDWTTAGSAA  300
PSSLSSDLQA GCSFDMDALA LQQEQQRCHP ILAPAMPSAP CSSMVTMADS ENCNGIIAGA  360
GANLPWLELG PNTWHLDELR WSEYFDGAFQ AAPSQQGALQ GQCVYGGGND DASTRPGTAV  420
RVAAGNTGRH ASLVDRTRTQ A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-2912523024128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365351e-131BT036535.2 Zea mays full-length cDNA clone ZM_BFb0120O20 mRNA, complete cds.
GenBankBT0410771e-131BT041077.1 Zea mays full-length cDNA clone ZM_BFc0171O14 mRNA, complete cds.
GenBankEU9554341e-131EU955434.1 Zea mays clone 1532080 myb-related protein Hv33 mRNA, complete cds.
GenBankKJ7274961e-131KJ727496.1 Zea mays clone pUT5355 MYB transcription factor (MYB156) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465218.11e-120transcription repressor MYB4
TrEMBLA0A0A9ASW41e-142A0A0A9ASW4_ARUDO; Uncharacterized protein
STRINGPavir.J03230.1.p1e-120(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.13e-76myb domain protein 61