PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zjn_sc00065.1.g01230.1.sm.mkhc

Organism

Zoysia japonica

Taxonomic ID

309978

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

M-type_MADS

Protein Properties

Length: 115aa MW: 13129.3 Da PI: 10.6642

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zjn_sc00065.1.g01230.1.sm.mkhc	genome	ZGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	83.2	1.6e-26	11	60	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+k+ rqv fskRr+g++KKA+EL LCdaeva+++fs+ gklyeyss Zjn_sc00065.1.g01230.1.sm.mkhc 11 RIEDKTSRQVRFSKRRAGLFKKAFELALLCDAEVALVVFSPGGKLYEYSS 60 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.6E-32	2	61	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	28.385	2	62	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.15E-33	3	61	No hit	No description
SuperFamily	SSF55455	1.31E-26	4	67	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.0E-27	4	24	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.8E-26	11	58	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.0E-27	24	39	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.0E-27	39	60	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 115 aa Download sequence Send to blast
MARRGPVELR RIEDKTSRQV RFSKRRAGLF KKAFELALLC DAEVALVVFS PGGKLYEYSS 60 TRSTQHNADE TDASELEKLE KLLTKALRDT KAKKGVSTLL KKFQFRACRL MAYLT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3kov_B	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3kov_I	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3kov_J	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3mu6_A	4e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3mu6_B	4e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3mu6_C	4e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3mu6_D	4e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_A	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_B	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_C	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_D	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_I	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_J	6e-17	4	61	2	59	Myocyte-specific enhancer factor 2A
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269\|PubMed:17951465}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT038349	6e-70	BT038349.1 Zea mays full-length cDNA clone ZM_BFb0228B20 mRNA, complete cds.
GenBank	BT068498	6e-70	BT068498.2 Zea mays full-length cDNA clone ZM_BFb0234P15 mRNA, complete cds.
GenBank	EU951938	6e-70	EU951938.1 Zea mays clone 1063645 mRNA sequence.
GenBank	EU961677	6e-70	EU961677.1 Zea mays clone 237541 MADS-box transcription factor 8 mRNA, complete cds.
GenBank	KJ726934	6e-70	KJ726934.1 Zea mays clone pUT3480 MADS transcription factor (MADS69) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002456860.1	2e-43	MADS-box transcription factor 51 isoform X1
Swissprot	Q9XJ61	1e-42	MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBL	A0A0D9V9N9	4e-50	A0A0D9V9N9_9ORYZ; Uncharacterized protein
STRING	LPERR01G36730.1	7e-51	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	2e-26	AGAMOUS-like 14

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465]