PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00044.1.g02960.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 435aa    MW: 46326 Da    PI: 6.4356
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00044.1.g02960.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-16111158148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg W++eEd++l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Zjn_sc00044.1.g02960.1.am.mk 111 RGLWSPEEDDKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 158
                                   788*******************************************97 PP

2Myb_DNA-binding51.52.4e-16164208147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++++eE++l+++++  lG++ W+ Ia+ ++ gRt++++k++w++y
  Zjn_sc00044.1.g02960.1.am.mk 164 RGAFSQEEEDLIIHLHSVLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 208
                                   89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-25106161IPR009057Homeodomain-like
PROSITE profilePS5129418.668106158IPR017930Myb domain
SuperFamilySSF466891.76E-29109205IPR009057Homeodomain-like
SMARTSM007177.3E-13110160IPR001005SANT/Myb domain
PfamPF002493.4E-15111158IPR001005SANT/Myb domain
CDDcd001672.01E-11114158No hitNo description
PROSITE profilePS5129426.796159213IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-26162213IPR009057Homeodomain-like
SMARTSM007171.9E-15163211IPR001005SANT/Myb domain
PfamPF002494.0E-15164208IPR001005SANT/Myb domain
CDDcd001675.86E-11166209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MIELMTTMHV IPDRLLAFQI ITTPGHESVK VKIIELEKES AVQRSAGQAV VEGRKESTCP  60
TDTARLSPSV RCPRLLATAV ELESSLGLLA AVAPAARMAR RVAGPKKKLR RGLWSPEEDD  120
KLMNHIAKYG HGCWSSVPKL AGLERCGKSC RLRWINYLRP DLKRGAFSQE EEDLIIHLHS  180
VLGNKWSQIA AQLPGRTDNE VKNFWNSYIK KKLRQRGIDP ATHKPLAVEA ASSGRAASAA  240
SSRSAVFVDA EFILSSTTAG QHMPPLAVTA ESYNDMYSHS SAEGGGSASA ALVGGACSDG  300
SLSLSGYNQT ADLATGYLDP AVVLPSVSSS STLNSIAGLS PAATDEQCNN SNSAFESTPS  360
CSAAATDHLP WLELGSSSYC TTAAAVDHYG AALDELKWSE YVFDGYGAAQ YQQPGQGVYG  420
DSKDAVQFDA DGLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-291092135108B-MYB
1h8a_C2e-2910021318128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0340161e-131BT034016.1 Zea mays full-length cDNA clone ZM_BFc0036C19 mRNA, complete cds.
GenBankBT0353991e-131BT035399.1 Zea mays full-length cDNA clone ZM_BFb0059D04 mRNA, complete cds.
GenBankBT0409891e-131BT040989.1 Zea mays full-length cDNA clone ZM_BFc0162L22 mRNA, complete cds.
GenBankBT0675251e-131BT067525.1 Zea mays full-length cDNA clone ZM_BFc0072I17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802131.11e-155transcription factor MYB61-like
TrEMBLA0A0A9P2E31e-160A0A0A9P2E3_ARUDO; Uncharacterized protein
STRINGSi029872m1e-146(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.12e-73myb domain protein 50