PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zjn_sc00040.1.g03080.1.sm.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 67aa MW: 7999.17 Da PI: 11.5123 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.6 | 3.5e-15 | 21 | 63 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r++r++kNRe+A rsR+RK a++ eLe+kv Le+eN++L+ Zjn_sc00040.1.g03080.1.sm.mk 21 RRQKRMIKNRESAARSRARKMAYTSELETKVSRLEEENERLRR 63 79***************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.3E-5 | 15 | 67 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.3E-15 | 15 | 64 | No hit | No description |
PROSITE profile | PS50217 | 11.576 | 19 | 67 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 8.9E-13 | 21 | 63 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.06E-11 | 21 | 65 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 24 | 39 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 67 aa Download sequence Send to blast |
MTAPGRKRGT TGYVEDKLME RRQKRMIKNR ESAARSRARK MAYTSELETK VSRLEEENER 60 LRRQKQA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025818578.1 | 3e-27 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1 | ||||
Refseq | XP_025818579.1 | 2e-27 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2 | ||||
Swissprot | Q9LES3 | 9e-25 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | A0A2S3HQM9 | 6e-26 | A0A2S3HQM9_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7DFC8 | 6e-26 | A0A2T7DFC8_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6R4U2 | 7e-26 | A0A3L6R4U2_PANMI; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
STRING | Traes_3AL_58F294736.2 | 6e-27 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2707 | 38 | 83 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 9e-19 | ABA-responsive element binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|