PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zjn_sc00013.1.g09340.1.sm.mkhc | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 142aa MW: 15971.2 Da PI: 10.3871 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57 | 2.7e-18 | 26 | 60 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++ Zjn_sc00013.1.g09340.1.sm.mkhc 26 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 60 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 4.04E-14 | 19 | 59 | No hit | No description |
PROSITE profile | PS50114 | 12.479 | 20 | 56 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 4.2E-15 | 20 | 84 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.5E-14 | 24 | 60 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 4.83E-14 | 25 | 60 | No hit | No description |
Pfam | PF00320 | 4.6E-16 | 26 | 60 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 26 | 51 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MDSSVEKGSG SLDPDEHPAA GEPKACTECH TTKTPLWRGG PCGPMSLCNA CGIRYRKKRR 60 EALGLDSSKS NADQQQQQRK KKTKREKERE EEGEVTVQLR SVGFGKEVVL KQRRRMRRRR 120 RLGEEERAAI LLMALSSGVV YA |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 77 | 84 | QRKKKTKR |
2 | 78 | 85 | RKKKTKRE |
3 | 111 | 117 | QRRRMRR |
4 | 113 | 118 | RRMRRR |
5 | 113 | 120 | RRMRRRRR |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP092837 | 2e-67 | FP092837.1 Phyllostachys edulis cDNA clone: bphyst009f16, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015631979.1 | 2e-63 | GATA transcription factor 16 | ||||
TrEMBL | A0A1E5US09 | 1e-62 | A0A1E5US09_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J03766.1.p | 7e-69 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 8e-19 | GATA transcription factor 15 |